SecReT6
Protein ID: 37526205
SecReT6 ID51
T6SS typei4b
Gene symbol-
Locus tagplu2292
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]2693522..2694625 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ7N4N3
KEGG IDplu:plu2292
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.40E-22, Aligned region: 58..119
ImpA-rel_N [PF06812], Evalue: 2.40E-22, Aligned region: 245..258
Protein Sequence: 367 a.a.     [Download]
>gi|37526205|ref|NP_929549.1| hypothetical protein plu2292 [Photorhabdus luminescens subsp. laumondii TTO1]
MNLAQTDIARFLQPIAADKPAGCDIEYEPIFEQINAARETDDDFLQDDTWGYETRQADWMKVSALCQEVL
EKQSKDLQIACWLTQAQGELYGLAGISGGITLLAHLLETFWPVLYPPLDDTEANSADARLGRLSWLDNQL
VKQLDNLTLTDDGKLSLSVWQRVQYFEQRAAVNSELRSALISDGYFGMAECDGSIRTTPAEQFNQLLTRA
EQVNKALAELQKIMVELLPDAGNSMSASTQRLQELVALIERFRDMVAPGSSQEYGNSNEAIAAGGDAPNG
MNTTFLTEDRAHHEMRAIAIGQMINIANYFRQNEPTSPVPYLIERAARWANMGMAEWLEEMMSENTSALQ
EIMRVMKGPEINREQNE
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c2694625-2693522 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
GTGAACTTAGCCCAAACAGATATCGCGCGTTTTTTACAACCGATTGCTGCTGACAAACCAGCAGGGTGCG
ATATCGAATACGAACCTATTTTTGAACAGATAAACGCCGCGCGTGAAACCGACGACGATTTTCTCCAAGA
CGACACATGGGGTTATGAAACCCGTCAGGCTGATTGGATGAAGGTTTCAGCGTTGTGTCAGGAAGTACTG
GAAAAACAGAGTAAAGATTTGCAGATAGCCTGCTGGTTAACCCAAGCGCAAGGGGAACTGTATGGTCTGG
CAGGGATTAGTGGCGGTATCACATTACTTGCCCATCTACTGGAAACTTTTTGGCCGGTGCTCTACCCGCC
GCTGGATGATACAGAGGCAAACAGTGCGGATGCCCGTCTTGGTCGGTTAAGCTGGTTGGATAATCAATTG
GTGAAACAATTGGACAATCTGACACTGACCGATGATGGCAAATTGAGCTTAAGCGTCTGGCAACGCGTGC
AATATTTTGAACAACGCGCTGCCGTTAATAGCGAATTACGCAGTGCCTTGATCAGTGATGGTTATTTCGG
TATGGCTGAGTGCGACGGCAGTATTCGCACTACACCCGCCGAACAATTTAACCAATTACTGACGCGGGCT
GAACAAGTTAATAAGGCATTAGCAGAACTGCAAAAAATCATGGTGGAACTATTGCCTGATGCCGGTAACA
GCATGAGTGCCAGTACGCAGCGATTGCAAGAGCTGGTGGCCTTAATCGAACGATTTCGTGACATGGTGGC
ACCGGGATCAAGCCAGGAATACGGCAATAGCAATGAAGCAATAGCGGCAGGGGGAGATGCGCCAAACGGC
ATGAATACGACTTTTTTAACAGAAGATCGGGCGCACCATGAAATGCGCGCTATCGCCATAGGACAAATGA
TCAATATCGCCAATTACTTTCGTCAAAATGAACCTACCAGTCCGGTGCCCTATTTAATTGAACGTGCAGC
ACGTTGGGCAAATATGGGCATGGCCGAATGGCTGGAAGAAATGATGTCAGAAAATACCTCCGCGCTACAA
GAAATTATGCGCGTGATGAAAGGACCAGAAATAAATAGAGAGCAAAATGAATAA