SecReT6
Protein ID: 37526208
SecReT6 ID51
T6SS typei4b
Gene symbol-
Locus tagplu2295
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]2695569..2697575 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ7N4N0
KEGG IDplu:plu2295
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.60E-60, Aligned region: 28..323
Phage_base_V [PF04717], Evalue: 3.20E-22, Aligned region: 357..450
Protein Sequence: 668 a.a.     [Download]
>gi|37526208|ref|NP_929552.1| hypothetical protein plu2295 [Photorhabdus luminescens subsp. laumondii TTO1]
MLLGQKNRFLQVIGNLSDIVALNKIEGEEHLSRPYSFSAQLYSNADWDKLESHIGKPLAFRLGEAPNHRI
VHGILTELQQQGFSDGQFCYQARIEPWLKMLTLTHNLRVYQRISVPDMVCDIFRKRGFNDVELALKSRYP
KLEYCMQYKESDFDFVTRQLEHAGIFYFFRHEERRHVLVLADHPSAFINAPLAVLPYQSKMGDQQGYGLR
AWHIHRTMIPGTAEMNGYNVKSAAAISASAKANSGYSTNPKLSIYDDRRQEERNQLETQATLCMEQWESQ
SYYARAVNSYPSLQVGHQFTLKGHTSADGRYAVGHQRLKAENNLEEGELLFSSQVTLFPANNVFRPRPSV
TRPYISGVLSALVVGPTSEEIHTDEQGRIKIQFHWDKEHKKDDDSSCWIRVSQFWNGAKFGAQFVPRVGN
EVLVSFIDGDPDSPLVTGTVYNGVKMPPFALPGQKTQSGITTRSSAKGTVEQGHQFCFEDKKGEEFILLH
SQKDMRLKVKNDFSAQIDRNVLWEIQEKRDTQIKKGNDTLILSEGNALTEVKKGDKKQTLDRGNFTTTVS
AGSYELEVSSGNAKINVGQQCTMTANQGIELKVGASTLSITPAGITIKAPSVTVEGSGKLALKSSGMAEL
TGTTVKVEGSAMAQLKGGIVQVDATGIAMVKGTLTKIG
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c2697575-2695569 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGCTATTAGGGCAAAAGAATCGTTTTTTACAGGTTATCGGTAACCTGTCAGATATTGTGGCACTGAACA
AAATAGAAGGTGAAGAGCACCTGTCACGACCTTATTCATTTTCTGCTCAGCTCTATTCCAACGCAGACTG
GGATAAGCTGGAGTCTCATATCGGTAAACCTTTGGCATTTCGTCTTGGCGAAGCGCCGAATCATCGCATT
GTGCATGGCATATTGACTGAATTGCAGCAACAAGGTTTTAGCGACGGCCAGTTTTGTTATCAAGCACGTA
TTGAACCCTGGCTGAAAATGCTGACATTAACCCATAATTTGCGCGTCTATCAGCGCATCAGCGTGCCGGA
TATGGTATGTGATATCTTCCGTAAACGTGGGTTTAACGACGTTGAACTGGCGCTAAAAAGCCGTTATCCG
AAGCTTGAATATTGTATGCAATACAAAGAATCAGATTTTGACTTTGTGACACGTCAACTGGAACACGCGG
GGATTTTCTATTTCTTTCGCCATGAAGAAAGGCGTCATGTACTGGTATTGGCAGATCACCCTTCGGCGTT
TATTAACGCACCGTTAGCGGTATTGCCATATCAATCGAAGATGGGTGATCAGCAAGGCTATGGGCTACGC
GCCTGGCATATTCATCGCACAATGATTCCAGGTACGGCGGAAATGAATGGTTATAACGTTAAAAGTGCTG
CGGCAATCAGTGCCAGCGCCAAAGCGAACAGCGGCTATTCTACCAATCCCAAGCTTTCTATCTATGACGA
CCGACGTCAGGAGGAACGTAACCAACTGGAAACACAGGCAACGCTGTGCATGGAACAATGGGAATCACAG
TCCTATTACGCACGCGCCGTTAACAGTTATCCCAGTTTACAAGTGGGGCATCAGTTTACCCTGAAAGGGC
ACACCAGCGCCGATGGCCGTTATGCCGTCGGCCACCAGCGATTAAAAGCGGAGAACAACCTGGAGGAAGG
TGAATTACTGTTTTCGTCTCAGGTGACCTTATTCCCGGCGAATAACGTATTCCGTCCGCGTCCTTCGGTT
ACGCGGCCCTACATTTCCGGCGTATTGTCCGCGTTGGTGGTAGGGCCGACGTCAGAAGAGATCCATACGG
ATGAACAGGGTCGCATCAAAATCCAGTTTCACTGGGATAAAGAGCATAAAAAAGATGATGACAGCTCCTG
CTGGATACGGGTCAGTCAGTTCTGGAATGGCGCAAAGTTTGGTGCACAATTTGTGCCACGTGTGGGCAAT
GAAGTCTTGGTGAGTTTTATTGATGGCGACCCGGATAGCCCGCTGGTGACCGGAACGGTTTATAACGGGG
TGAAGATGCCACCATTCGCGCTACCGGGGCAGAAGACCCAAAGCGGGATTACGACACGCAGTAGTGCAAA
AGGCACGGTGGAGCAAGGACATCAGTTCTGTTTCGAAGATAAAAAAGGTGAAGAGTTTATTTTGCTTCAC
TCACAAAAAGATATGCGCCTGAAAGTGAAAAATGATTTTTCGGCGCAGATCGATCGCAACGTGTTATGGG
AAATCCAAGAAAAGCGCGATACCCAAATTAAAAAGGGCAATGACACATTAATTTTGAGCGAGGGCAACGC
CTTAACTGAGGTGAAAAAAGGTGACAAAAAACAAACGCTGGATCGTGGCAATTTTACCACCACCGTCAGT
GCAGGCAGTTATGAGCTGGAAGTATCCAGCGGTAACGCCAAAATCAATGTCGGTCAACAATGCACAATGA
CGGCAAATCAGGGCATTGAACTGAAAGTCGGTGCCAGCACATTATCGATTACCCCGGCCGGGATCACCAT
CAAAGCGCCATCGGTTACCGTAGAAGGATCAGGAAAACTGGCGTTGAAGAGCAGTGGCATGGCGGAGCTA
ACTGGCACCACGGTAAAAGTAGAAGGCAGTGCAATGGCACAGCTAAAAGGCGGCATTGTTCAGGTGGATG
CGACCGGCATTGCTATGGTGAAAGGCACTTTGACCAAGATTGGTTAA