SecReT6
Protein ID: 37526209
SecReT6 ID51
T6SS typei4b
Gene symbol-
Locus tagplu2296
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]2697600..2698610 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ7N4M9
KEGG IDplu:plu2296
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-75, Aligned region: 13..315
Protein Sequence: 336 a.a.     [Download]
>gi|37526209|ref|NP_929553.1| hypothetical protein plu2296 [Photorhabdus luminescens subsp. laumondii TTO1]
MAIENKMRLVGGRFYQNVRRLLKRCRQREETAIIPDDVVQFSSVLTLDAPEREVESLLPPQEGDEQYRMA
VHHFGLLGTLGALPLRYTEWLIDRRYRYGDESAQAFIDIFTHRLLSLRFQAWQKYRLYINTELQNHAELQ
NHAELQNHAEWQNYRALPAVIPAVAGQLMADTTQRSHPACVGLLATPVRSMVNLQQLLQRELGMAVSIQP
FKGRWQYAEQAHCCCLGRSLLGDNPMLGRAYWDIQSGFHIQLGPFAARQRAAFMPGNEQYRKLTQWVWQF
AGPLLSFSLELLVQHSGQGNILNGSRQLGWDGCLGDTGESNIQRLYLAECTGPYAN
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c2698610-2697600 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGGCTATAGAAAATAAAATGCGTTTAGTTGGCGGCCGTTTTTATCAAAATGTACGTCGTCTGCTTAAAC
GTTGTCGCCAGCGTGAAGAAACGGCAATCATCCCTGATGATGTGGTGCAATTCAGTTCGGTACTGACATT
AGATGCGCCGGAAAGGGAAGTCGAGTCGCTATTACCACCGCAAGAGGGGGATGAACAGTATCGCATGGCG
GTACATCACTTTGGTCTATTAGGCACCCTTGGCGCATTACCATTGCGTTATACCGAATGGTTGATTGACA
GGCGTTACCGCTATGGTGACGAATCAGCTCAGGCGTTTATTGATATTTTTACTCATCGTCTGCTTAGCCT
GCGTTTTCAGGCATGGCAGAAATACCGGTTATATATTAATACCGAGTTACAAAACCATGCCGAGTTACAA
AACCATGCCGAGCTACAAAACCATGCGGAATGGCAAAATTATCGGGCTTTACCGGCAGTCATTCCAGCAG
TTGCCGGCCAATTGATGGCGGACACCACACAGCGTTCTCATCCCGCCTGTGTCGGGTTGCTGGCAACACC
GGTCCGCTCAATGGTGAATTTGCAGCAGCTATTGCAGCGGGAATTGGGTATGGCAGTCAGCATCCAGCCC
TTTAAAGGGCGCTGGCAATATGCTGAACAGGCACACTGTTGCTGTTTAGGTCGCAGTTTGTTAGGCGATA
ACCCGATGTTGGGTCGCGCTTATTGGGATATTCAATCAGGATTTCATATTCAGTTGGGGCCGTTTGCCGC
TCGGCAACGAGCCGCCTTTATGCCGGGAAATGAACAATATCGCAAACTGACACAATGGGTGTGGCAATTT
GCCGGACCGCTGCTCTCCTTTTCACTGGAATTGTTGGTACAGCATAGCGGGCAAGGCAATATATTAAATG
GCAGCCGCCAATTGGGGTGGGATGGTTGTTTGGGCGATACCGGCGAAAGCAATATTCAGCGTCTCTATTT
GGCTGAATGTACAGGTCCCTACGCAAATTAA