SecReT6
Protein ID: 37526210
SecReT6 ID51
T6SS typei4b
Gene symbol-
Locus tagplu2297
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]2698601..2700412 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ7N4M8
KEGG IDplu:plu2297
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-167, Aligned region: 9..599
Protein Sequence: 603 a.a.     [Download]
>gi|37526210|ref|NP_929554.1| hypothetical protein plu2297 [Photorhabdus luminescens subsp. laumondii TTO1]
MMLLPQKILTYYNRELSYLRQYGAAFSQRFPKIAKRLGFAEGVSEDPHVERLVESFAFLTAKIHQRIDED
MPELSNAMLEVLAPQFLRQVPSVSLVQFQQDLLTSGVTGMMTVARHTPLISQPVGDVTCRFRTVYPLEML
PLDLTHAELIPDPYDRDFILTLNFTLWPGASFQAQHIRLYLHGAPMLTHSLYELLSAQVKQLECRLGERT
FNLNRRGVQVVGFDPQDNLCADDPLINPVHHLFRDYFSFPEKFLFLDIPLPDAGLITRSLGELQYRFRLK
DCVALRRIERMSDKVSNETFRLNCVPIINLFPHHAEPIIPLETEHEYLVQPDARRPQSMEVYTIDQVEIV
SRQQEQLSSKPVPSLFGIGHTQSDEQFSLFWQATPRPSLRHNDLGMNMFIGFSDSSGEHLKPETDVVILS
LTCTNRDIPRQLSNGHPDGDFESESALPGVKILGLIRPRLPVRPQPNSALNWRLVSQLNLNQMLLSGPQG
VQCLKETLELYNLLGDPAISRLIAQLQQIAIAPVSARLNPADPYSLARGLEVTLTFQAQAGEFVDFYLFC
SLLERFIAMYTPINSFTQTVTQLETINNSTRRWPRRSGRLTWL
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c2700412-2698601 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGATGTTATTACCACAAAAAATACTGACTTATTACAACCGGGAATTGAGTTATTTAAGACAATATGGCG
CTGCTTTCTCGCAGCGTTTTCCTAAAATTGCTAAACGTCTTGGGTTCGCAGAAGGTGTTTCAGAAGATCC
GCATGTAGAACGTCTGGTGGAATCTTTTGCATTTCTGACAGCAAAAATCCACCAGCGGATTGATGAAGAT
ATGCCGGAACTGAGCAACGCCATGTTAGAGGTATTAGCGCCACAGTTTCTACGTCAGGTACCGTCGGTAT
CGTTGGTGCAGTTTCAACAGGACCTGTTAACATCCGGTGTGACCGGAATGATGACGGTAGCGCGGCATAC
TCCGTTGATTTCTCAACCGGTAGGTGATGTGACATGTCGTTTCCGCACGGTATATCCGCTGGAGATGTTG
CCATTGGATTTAACGCATGCAGAACTAATACCAGACCCTTACGATCGGGATTTCATCTTAACGCTGAATT
TTACCTTGTGGCCGGGTGCCAGCTTTCAGGCACAACATATCCGGTTGTACTTACATGGCGCGCCAATGCT
GACCCATAGCTTGTATGAATTGTTGTCGGCCCAAGTTAAGCAACTGGAATGTCGGTTAGGCGAGCGTACA
TTCAACCTGAATCGCCGAGGTGTTCAGGTGGTGGGCTTTGATCCGCAAGATAACTTATGTGCCGATGATC
CATTGATAAATCCGGTTCACCACTTGTTTCGTGATTATTTCAGTTTCCCAGAAAAATTCTTATTCTTGGA
TATTCCACTACCGGATGCTGGTTTGATTACCCGTTCATTAGGTGAGCTGCAATACCGTTTTCGGCTTAAG
GATTGTGTCGCATTGCGCCGCATTGAACGTATGAGTGATAAAGTCAGCAACGAAACCTTCCGGCTAAATT
GCGTGCCGATAATTAATCTGTTTCCTCATCATGCGGAACCCATTATTCCACTGGAAACAGAGCATGAATA
TCTGGTTCAACCGGATGCGCGTCGCCCACAAAGTATGGAAGTCTATACCATTGATCAGGTCGAAATTGTC
AGCCGTCAGCAGGAACAATTAAGTTCCAAACCGGTGCCGTCATTATTTGGTATTGGGCATACGCAATCTG
ACGAACAGTTCTCATTGTTTTGGCAGGCAACGCCACGTCCCTCACTCAGACATAACGATCTTGGGATGAA
TATGTTCATCGGTTTTTCTGATAGCAGTGGCGAACATCTGAAACCCGAAACCGATGTGGTGATCTTGAGT
CTGACCTGTACTAATCGCGATATACCGCGGCAATTAAGCAACGGTCATCCTGATGGGGATTTCGAATCAG
AAAGCGCGTTGCCAGGGGTAAAAATTCTGGGATTGATCCGTCCCCGATTGCCGGTACGTCCACAACCCAA
TAGTGCATTGAACTGGCGGTTGGTATCGCAACTCAATTTGAACCAAATGCTACTGAGTGGTCCGCAAGGA
GTTCAATGTTTAAAAGAGACGCTAGAACTCTACAACCTGCTTGGCGATCCAGCCATATCGCGGTTGATTG
CACAATTACAGCAGATTGCGATTGCGCCAGTAAGTGCACGCTTGAATCCCGCCGATCCCTATTCTCTGGC
GCGTGGGCTGGAGGTGACATTAACATTTCAGGCACAAGCCGGGGAATTTGTTGATTTTTACCTGTTTTGC
AGCTTGTTAGAACGTTTTATCGCAATGTATACACCGATTAACAGCTTCACGCAGACCGTAACACAGTTAG
AGACGATTAATAATAGTACCCGCCGTTGGCCACGTCGCAGTGGGAGGCTGACATGGCTATAG