SecReT6
Protein ID: 37526212
SecReT6 ID51
T6SS typei4b
Gene symbol-
Locus tagplu2299
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]2700912..2701406 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ7N4M6
KEGG IDplu:plu2299
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.40E-33, Aligned region: 6..139
Protein Sequence: 164 a.a.     [Download]
>gi|37526212|ref|NP_929556.1| hypothetical protein plu2299 [Photorhabdus luminescens subsp. laumondii TTO1]
MSSSIFLQIDGIKGESTDSKHKEWIELEHVNFGLFNHARIADSGKRKITVGAADFRTIDCVKVMDSSSIG
LLSAVAQGTAIKKVKLEICTIFKGEMHPYAEVEMDECIISDVHETCSRGGEFPQEQISIAYSKIKWTFTP
LKEDGTKGTKVGPEGWDLIENKKQ
 
Nucleotide Sequence: 495 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c2701406-2700912 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAGTTCTTCAATCTTTTTACAAATTGATGGTATTAAAGGTGAAAGTACCGACAGCAAACATAAAGAGT
GGATTGAGCTGGAACATGTCAATTTTGGTCTATTTAACCATGCACGTATTGCAGACAGCGGTAAACGTAA
AATTACCGTTGGTGCAGCAGATTTCCGTACCATTGACTGTGTGAAGGTGATGGATTCCAGTTCTATTGGC
TTACTGTCTGCTGTGGCGCAAGGTACCGCGATTAAGAAAGTGAAACTGGAAATCTGCACGATTTTCAAAG
GCGAAATGCATCCTTATGCGGAAGTGGAAATGGACGAATGTATTATCTCTGACGTTCATGAAACCTGTTC
ACGTGGCGGTGAATTCCCACAAGAACAGATTTCTATCGCCTATTCCAAAATTAAATGGACATTTACACCA
CTCAAAGAAGACGGAACTAAAGGAACTAAGGTGGGACCGGAAGGTTGGGATCTTATCGAGAACAAAAAAC
AATAA