SecReT6
Protein ID: 37526213
SecReT6 ID51
T6SS typei4b
Gene symbol-
Locus tagplu2300
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]2701463..2702944 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ7N4M5
KEGG IDplu:plu2300
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.60E-182, Aligned region: 66..488
Protein Sequence: 493 a.a.     [Download]
>gi|37526213|ref|NP_929557.1| hypothetical protein plu2300 [Photorhabdus luminescens subsp. laumondii TTO1]
MEQSVVEQQELKTTETSGDFLDQIIDNTQAIRREADRDRVKSQLDQFLAEVTSGSLVVSGDLVNSIDERI
AAIDALMSAQLSLVLHHPEFQRLESSWVGLKGLLDQSETDNTQIRMLNATKTDLIKDFKSASDFDQSMLF
KNVYEYEYGTFGGEPYSAFVGDFDFDNSPEDLYLLEQISHVAAAAHAPFISSVNAGMLGLNDFGELPRPR
DLSKLLATSDYLRWKRFRESDDSRYVGLTLPRVIGRLPYGAKTIPVEQFCFEEQVKEGDSGSYLWINAAY
ALAGRMVAAFEQYGWCAAIRGVEGGGLVEALPAYHYTSVSGENVLQCPTEVAISDRREKELAELGFIPLV
YYKGTDYAAFFSVQSPNKPRKYNSDLANANAKLSTQLQYIMTTSRFAHYLKMIVRDKVGSFMSRGECQSY
LQNWINQYIVGSDTVGAEIKASHPLREARVDVVEVPGSPGTYRAVAYLRPHFQLEGLSMSLRLVADLPPS
SAA
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c2702944-2701463 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGGAACAGAGCGTTGTTGAACAACAAGAATTGAAAACGACGGAAACAAGTGGTGATTTTCTTGATCAAA
TTATTGATAACACCCAAGCCATTCGTCGAGAAGCCGATCGTGATCGGGTAAAAAGCCAGCTCGACCAGTT
TCTGGCCGAAGTCACCTCCGGTTCACTGGTGGTTTCCGGCGATTTGGTAAACAGCATTGACGAACGTATC
GCCGCGATTGATGCGCTGATGTCCGCTCAACTGAGTCTGGTATTACATCACCCGGAATTTCAGCGTCTGG
AATCTTCTTGGGTAGGGCTTAAAGGATTACTTGACCAAAGCGAAACGGATAATACCCAAATCCGCATGTT
GAACGCGACGAAAACCGATTTGATTAAAGATTTTAAATCGGCATCGGATTTCGATCAGTCAATGCTGTTT
AAAAATGTGTATGAATATGAATACGGTACCTTTGGTGGTGAACCTTATTCCGCATTTGTCGGTGATTTTG
ACTTTGATAACAGCCCGGAAGATCTCTACTTACTGGAGCAGATTTCTCATGTGGCCGCAGCCGCCCATGC
GCCGTTTATCAGTTCAGTCAACGCGGGCATGTTGGGGCTGAATGATTTTGGTGAACTACCACGTCCACGT
GATTTATCCAAACTGCTTGCAACATCCGATTATCTGCGTTGGAAACGCTTCCGGGAATCTGATGACTCTC
GTTATGTCGGCTTGACGTTACCACGAGTAATTGGCCGTTTGCCTTATGGGGCAAAAACCATCCCGGTTGA
ACAATTCTGCTTCGAAGAGCAGGTAAAAGAAGGGGATAGCGGTAGTTATCTGTGGATTAACGCCGCCTAT
GCACTGGCAGGCCGTATGGTGGCTGCATTTGAACAGTATGGTTGGTGTGCTGCGATCCGTGGTGTAGAAG
GCGGAGGATTGGTCGAAGCATTGCCAGCGTATCACTATACCTCTGTGTCCGGTGAAAATGTGCTGCAATG
CCCGACTGAGGTGGCTATCTCTGATCGCCGCGAAAAAGAGTTAGCAGAATTAGGGTTCATTCCTCTGGTT
TATTATAAAGGAACTGACTATGCCGCATTTTTTTCGGTACAGTCACCAAATAAGCCGAGAAAATATAATT
CTGACCTGGCAAATGCCAACGCAAAATTATCAACCCAATTGCAATATATTATGACAACATCTCGTTTCGC
CCATTATTTGAAAATGATTGTGCGTGACAAAGTGGGCAGTTTTATGTCCCGCGGAGAATGTCAATCTTAT
CTGCAAAACTGGATCAACCAATATATTGTTGGCTCTGATACCGTTGGTGCGGAAATAAAAGCGAGTCACC
CATTACGGGAGGCAAGAGTTGATGTTGTTGAAGTTCCTGGATCACCGGGAACATATCGGGCTGTAGCCTA
TTTAAGGCCGCATTTCCAATTAGAAGGATTAAGTATGTCTTTACGGTTGGTTGCTGATTTACCGCCATCA
TCGGCTGCCTGA