SecReT6
Protein ID: 37526214
SecReT6 ID51
T6SS typei4b
Gene symbol-
Locus tagplu2301
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]2702952..2703503 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ7N4M4
KEGG IDplu:plu2301
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.10E-49, Aligned region: 7..148
Protein Sequence: 183 a.a.     [Download]
>gi|37526214|ref|NP_929558.1| hypothetical protein plu2301 [Photorhabdus luminescens subsp. laumondii TTO1]
MNTQRKLDKVRPPRVQITYDVELGGAVEKKELPLVIGVIGQFAEQSIPMRERRFMQVDKDNFNAVMEGLS
PSLELQVESALPGQSGFMNVDLQFKSMADFTPENLAKQIEPLRHLLEVRGKLSDLKGRALSNEKLRDRLA
EILAEHADKLPQANEEAETAAIENRADDVTPENSNIPENNNAQ
 
Nucleotide Sequence: 552 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c2703503-2702952 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAATACTCAACGTAAGCTTGATAAAGTCAGACCGCCCCGAGTTCAGATTACTTATGATGTTGAATTAG
GTGGCGCGGTCGAGAAAAAAGAATTGCCTTTGGTTATTGGCGTTATTGGGCAATTTGCTGAGCAATCTAT
TCCCATGCGTGAACGTCGTTTTATGCAGGTTGATAAAGATAATTTTAATGCAGTGATGGAAGGTTTATCA
CCTTCATTGGAATTACAGGTTGAAAGTGCGCTGCCGGGTCAGAGCGGATTTATGAATGTCGATTTGCAAT
TTAAATCAATGGCTGACTTTACCCCAGAGAATTTGGCGAAACAGATAGAACCGCTTCGTCATTTATTAGA
GGTACGCGGCAAACTCAGTGATTTGAAAGGCCGTGCATTGAGCAATGAAAAATTGCGTGACCGTCTGGCG
GAAATTCTAGCTGAACATGCGGATAAATTACCGCAAGCAAATGAAGAAGCAGAAACCGCTGCCATAGAAA
ATAGAGCAGATGACGTCACCCCGGAAAATAGCAATATCCCGGAAAATAACAATGCACAGTGA