SecReT6
Protein ID: 37527105
SecReT6 ID52
T6SS typei2
Gene symbol-
Locus tagplu3222
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]3810052..3810480 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ7N269
KEGG IDplu:plu3222
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.50E-17, Aligned region: 26..113
Protein Sequence: 142 a.a.     [Download]
>gi|37527105|ref|NP_930449.1| hypothetical protein plu3222 [Photorhabdus luminescens subsp. laumondii TTO1]
MKKPSLYESLFGNFNCGLELHQVSEEEQVILSVLDNMQRILNSRAGSLTHLPDYGLPDLNTILRGLPTSS
QRLISTIEHTLLTYEPRLKRVDITLLPELAPGHLRYDINAELKGVGLVRFSTEFVPEGNVLIRHLRQQGY
VD
 
Nucleotide Sequence: 429 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c3810480-3810052 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAAAAAACCTTCTCTGTATGAAAGCCTTTTCGGCAATTTTAATTGCGGTCTGGAGTTGCATCAGGTGA
GTGAAGAAGAGCAAGTTATTTTGTCGGTATTAGACAATATGCAGCGTATCCTCAATAGTCGTGCCGGTTC
GCTTACCCATCTGCCCGATTATGGCCTGCCTGATCTCAACACTATTCTGCGAGGGTTGCCTACGTCGTCA
CAGCGCTTGATCTCGACGATTGAACATACCTTGTTGACTTATGAACCGCGTTTGAAACGAGTTGATATCA
CGTTATTGCCGGAGCTGGCACCGGGGCATCTGCGTTATGACATCAATGCTGAACTCAAAGGTGTGGGGCT
GGTGCGTTTCAGCACTGAGTTTGTACCGGAAGGGAATGTGTTGATCCGCCATTTACGCCAGCAAGGGTAT
GTGGATTAG