SecReT6
Protein ID: 37527106
SecReT6 ID52
T6SS typei2
Gene symbol-
Locus tagplu3223
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]3810485..3811024 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ7MB16
KEGG IDplu:plu3223
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.80E-32, Aligned region: 17..169
Protein Sequence: 179 a.a.     [Download]
>gi|37527106|ref|NP_930450.1| hypothetical protein plu3223 [Photorhabdus luminescens subsp. laumondii TTO1]
MLTIPFYKMVPVMATIALLLTGCGLTQTVTDGTAAATRSFFHKRVKTLHLDFIPRAAVNTDTGESVALSV
PALVRVYQLRDNNAIKKVDYADLLDDGDRILGADCLASEEVVVKPGSHASLDMPMAAQAKYVAVVGLFRN
PDVAKGTWRRIIKRNELLPDSPRIIALNAGGLTLLPEKG
 
Nucleotide Sequence: 540 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c3811024-3810485 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGTTAACTATCCCTTTTTATAAAATGGTGCCGGTAATGGCGACGATAGCATTACTACTGACAGGCTGTG
GTCTGACTCAGACCGTGACTGATGGCACGGCAGCGGCCACCCGGTCCTTTTTTCATAAGCGGGTGAAAAC
GTTGCATCTGGATTTTATTCCACGGGCAGCGGTTAATACCGACACGGGAGAAAGTGTTGCTCTGTCCGTT
CCGGCATTAGTTCGGGTTTATCAGTTGCGGGATAACAACGCTATAAAAAAGGTGGATTATGCGGATTTGT
TGGATGACGGCGACCGGATACTGGGCGCTGATTGTCTGGCGAGTGAAGAGGTAGTGGTGAAACCGGGTAG
TCACGCATCGCTTGATATGCCGATGGCGGCGCAGGCGAAATATGTGGCGGTGGTGGGATTATTCAGAAAC
CCCGATGTAGCCAAAGGGACTTGGCGTCGGATCATAAAACGCAACGAGTTGTTACCAGATAGTCCTCGTA
TTATTGCGCTTAATGCCGGTGGCTTGACTTTATTACCTGAAAAGGGGTGA