SecReT6
Protein ID: 37527107
SecReT6 ID52
T6SS typei2
Gene symbol-
Locus tagplu3224
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]3811002..3812090 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ7N268
KEGG IDplu:plu3224
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.50E-82, Aligned region: 19..320
Protein Sequence: 362 a.a.     [Download]
>gi|37527107|ref|NP_930451.1| hypothetical protein plu3224 [Photorhabdus luminescens subsp. laumondii TTO1]
MGRTTLSEHSRLMAILESEISTLDFYQFCQMIERAVPDRPPLGSTENPVDDAIRLRPHPGLGFPASELKA
IETDSEHPERPPTARTNFMGLYGVDSSLPTAYLNDIVQQREGNETIEAFLDIFNHRMFTQFYRIWRKYSY
PATFATGGTDRTSQCLLGLIGLGIPGSQQQIATPMSRFLALLSVMRLPTRTAEGVSALVALLAPQTRIVV
TPACPRQIHLMQPANLSDTHRISLSQRTVLGRMGTDINSQLLLALHTDCPDEAWGWLPGGQLHTDFLVLL
RVYLGWRYQARLQLTLPTRILPPPLLGGQPVRLGLTGVLGLKAENHQLAVPDNITVNLGCYQGISPDSNQ
DKGGDYVNYPFL
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c3812090-3811002 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGGGAAGAACAACACTGTCAGAACATTCCCGGTTGATGGCAATACTGGAATCGGAGATTTCGACACTCG
ATTTCTACCAATTCTGTCAGATGATTGAACGTGCAGTTCCTGATCGGCCGCCTCTGGGGAGTACGGAAAA
TCCGGTTGATGATGCGATACGTTTGCGGCCTCATCCTGGTCTGGGATTTCCCGCCAGTGAATTGAAAGCG
ATAGAAACTGACAGTGAACATCCAGAGCGTCCACCGACAGCCAGAACAAACTTTATGGGACTGTATGGAG
TAGATTCTTCGTTGCCAACCGCTTACCTGAACGATATCGTTCAGCAAAGGGAAGGGAATGAAACTATCGA
AGCCTTTCTGGATATTTTTAACCACCGGATGTTCACCCAGTTTTATCGTATCTGGCGTAAATACTCCTAT
CCGGCAACTTTTGCTACCGGAGGAACCGATAGAACCTCCCAATGTCTGCTCGGATTGATTGGCTTAGGGA
TACCGGGTAGTCAGCAACAGATTGCCACGCCGATGTCCCGTTTTCTGGCGCTGCTCAGTGTTATGCGTCT
GCCAACTCGAACCGCTGAAGGCGTATCGGCGCTGGTGGCATTGTTGGCACCGCAAACCCGGATCGTGGTG
ACACCTGCTTGCCCGCGACAGATCCATCTGATGCAACCGGCGAATCTTTCAGACACTCACCGAATTTCCC
TCTCGCAGCGTACCGTGCTAGGCAGAATGGGCACTGATATCAATAGCCAGTTATTGCTGGCGCTGCATAC
CGATTGCCCGGATGAAGCGTGGGGCTGGTTGCCGGGCGGGCAGTTGCACACTGATTTTTTGGTGTTGTTA
CGGGTTTATTTAGGCTGGCGATACCAAGCCAGATTGCAACTGACTCTGCCGACCCGAATATTACCGCCAC
CGCTGCTAGGTGGTCAGCCTGTTCGGTTAGGGCTAACAGGAGTATTAGGGTTAAAGGCTGAAAATCATCA
GCTAGCAGTGCCTGACAACATTACGGTGAATTTGGGGTGTTATCAGGGGATATCACCAGACAGCAATCAA
GACAAAGGGGGAGATTATGTTAACTATCCCTTTTTATAA