SecReT6
Protein ID: 37527108
SecReT6 ID52
T6SS typei2
Gene symbol-
Locus tagplu3225
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]3812054..3813814 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ7N267
KEGG IDplu:plu3225
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.80E-184, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|37527108|ref|NP_930452.1| hypothetical protein plu3225 [Photorhabdus luminescens subsp. laumondii TTO1]
MDDLTLRYYEAEMRYLREAGREFAKAHPDRAAALNLDKIVMRDPFVERLFEGFAFMIGSLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSIVEFGMDWAQLKNSVQVKKGFEILSQPIGPSKTRCRYTTTQAVQLLPLA
LTDASLQEEPNGRSVIRLRFDCGTLVDWHQIDLSCLPLYLSADSPLAYALHRAFTLQTQQLYLRLPGQPD
RQPFDGRFSPMGFGEEERLWPKGESSFSGYQLLLEYFTFREKFMFVTLCGLEKLTLPERTPWFELDVVLR
ESWPFDLPFSAEHIRLHCTPVINLFRLESDPLQLAPLQTEYLLYPVRYQDGHTEVYSVDEVSSSKREGHQ
YVPFSSFRHKGGMLRHDAPECYFHTRVKRGPSGLCDTWIILGGADFDDNELDEEDILSLTLTGTNGQLPR
RALQDTLLNTAVNPPLAEFTVRNLCEPTLPCYPPNRDRFHWRVLSHLGSNFLSMMDNPEVLRGTLALYDW
SDNEMNYRRLEAIVAVKHSLIERFEQGSLRRGVHIEVTLDSNGFAGAGDICLFGEMLSRFFALYTDIHLF
NRLTLILQPTGERLLWEEQHCQNIPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c3813814-3812054 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGGATGATTTAACCCTGCGCTATTATGAGGCAGAAATGCGCTATCTGCGTGAAGCAGGCAGAGAGTTTG
CTAAGGCCCATCCTGACCGAGCAGCCGCGCTTAATCTGGATAAAATCGTTATGCGTGATCCTTTTGTGGA
GCGTCTGTTTGAAGGCTTTGCTTTTATGATCGGGAGTCTGCGTGAGAAGCTGGATGATGACTTGCCGGAG
TTGACGGAAGGGCTGGTTAGTTTGTTGTGGCCGCATTACCTACGCACGATTCCGTCCCTTTCCATTGTTG
AATTTGGGATGGATTGGGCACAGTTGAAAAATTCGGTACAGGTGAAAAAGGGTTTTGAGATCCTTTCGCA
ACCGATCGGCCCAAGCAAGACTCGGTGTCGTTATACCACAACTCAGGCGGTCCAGTTACTGCCTCTGGCA
CTGACCGACGCTTCCCTGCAAGAGGAACCGAATGGGCGTTCCGTGATTCGATTGCGTTTTGACTGTGGAA
CACTGGTGGACTGGCACCAAATTGATTTGAGCTGTTTACCGCTGTATCTCAGTGCTGACAGTCCGCTGGC
CTATGCGTTACATCGAGCGTTTACGCTGCAAACCCAACAGCTTTACCTGCGTTTACCCGGTCAGCCCGAT
CGTCAGCCATTTGACGGCCGATTCTCACCAATGGGGTTTGGCGAAGAGGAAAGGTTATGGCCGAAAGGGG
AAAGTTCGTTCAGTGGTTATCAACTACTGCTGGAGTATTTCACTTTCCGTGAAAAGTTTATGTTTGTTAC
GCTCTGTGGGCTGGAAAAGTTGACTCTCCCCGAGAGAACGCCGTGGTTTGAGCTGGATGTGGTTCTGCGT
GAAAGTTGGCCCTTTGATTTGCCATTTTCTGCCGAGCATATCCGTTTGCACTGTACCCCGGTGATTAATC
TGTTTCGGTTGGAATCCGATCCGCTTCAACTGGCACCGTTGCAAACTGAGTATTTGCTGTATCCGGTCCG
CTATCAGGATGGGCATACCGAGGTTTATTCCGTGGATGAGGTGTCTTCTTCGAAACGCGAGGGCCATCAG
TATGTGCCGTTCAGTAGTTTCCGTCATAAAGGCGGCATGTTGCGCCATGATGCACCGGAGTGCTACTTCC
ATACCCGTGTGAAACGCGGGCCATCAGGTCTGTGTGACACCTGGATTATTCTGGGTGGAGCGGATTTTGA
TGATAATGAACTGGACGAAGAAGATATCTTATCTCTCACGTTGACTGGCACTAATGGTCAACTGCCGCGT
AGGGCGTTGCAGGATACGCTGTTGAATACCGCCGTTAATCCTCCGTTGGCGGAATTTACGGTACGTAACC
TGTGTGAACCGACATTGCCCTGTTATCCACCCAATCGGGACCGTTTCCACTGGCGAGTGCTCAGCCATCT
GGGTTCTAACTTTCTTAGCATGATGGATAACCCGGAAGTGCTACGCGGGACATTAGCCCTGTATGACTGG
TCCGACAATGAGATGAACTATCGCCGTCTGGAGGCGATTGTCGCGGTGAAGCATTCGCTGATTGAGCGAT
TTGAGCAGGGAAGTTTGCGGCGGGGCGTGCACATTGAAGTGACATTGGATAGCAACGGCTTTGCAGGTGC
CGGTGATATCTGCTTGTTTGGCGAAATGCTCAGCCGCTTCTTTGCCTTGTACACCGATATTCATCTGTTT
AACCGACTTACGCTGATTTTACAACCTACGGGGGAACGACTGTTATGGGAAGAACAACACTGTCAGAACA
TTCCCGGTTGA