SecReT6
Protein ID: 37527120
SecReT6 ID52
T6SS typei2
Gene symbol-
Locus tagplu3237
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]3827457..3829982 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ7N257
KEGG IDplu:plu3237
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.00E-55, Aligned region: 34..361
DUF2345 [PF10106], Evalue: 1.90E-47, Aligned region: 619..766
T6SS_Vgr [PF13296], Evalue: 8.30E-39, Aligned region: 494..602
Phage_base_V [PF04717], Evalue: 5.00E-18, Aligned region: 399..487
Protein Sequence: 841 a.a.     [Download]
>gi|37527120|ref|NP_930464.1| hypothetical protein plu3237 [Photorhabdus luminescens subsp. laumondii TTO1]
MTNLTPMIIFDHSRYRLKVWRNKAPLDVLAFTGQEALSQPFRYAIEFTSAEKGIEPAQMLMQQASFTLTS
PAINPGIRWMPIVPPEPLRSVYGVISGFKLLSTSRDESRYEVTLEPRLALLARSHQYAIYQKLSVPEIVE
KILRERHGFRGQDFLFSLAYSYPRREQVMQYGEDDLRFIQRMLAEVGIWYKVTADDRLKIDVVEFYDDQR
DYQFNVYLPARNPSGMHGEEDAVVWGMETAYQVVEGKIATRNYDYHDARPYPGLNTEADVTRGDRTTYGE
AYHYRDDYRIPGDRYAYQPETESGVFYARLHHERYLNQRIRLRGMTTSATLVPGQELKVKGDAPETFRKG
AIITQITNSARRDSSFEMTFTAIPYSETVCFRPERVPKPVMAGTIPARVSSTKVNDTYGDIDKDGLYRVV
FNFDREKWPQGGESLWVRLARPYAGENYGFHWPLLEGTEVAIAFEGGDPDRPYIAHALHDSVHPDHVNLY
NYKRNVLRTPANNKLRMDDERGREHIKLSTEYGGKSQLNLGHLVDSQRPHPDKRGEGFELRTDDWGAIRA
GKGLFISADKQARAGGEVLEMEAALNQLQQAQTLTEALYGAAEMAKAELADLQQQKALLSETLAELKKSA
LLLSAPEGIAQTTAKSLQLAAGENIIVTSGKSTDFSVLKKFTVAAGERISLFAQKLGIKLFASKGRVDIE
AQGDEMGLAALKDITVNSHEGKVIISAKQEILLVSGGGYIRIGNGQVECGAPNHIIQRAAVWQKFDGQSV
SQTVQQWQTANYAVTPKAVRAYKISPLDRQNMQFHAEDGGVQALSTIQNGKTPLQKQVGVEISQLKIKDE
E
 
Nucleotide Sequence: 2526 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c3829982-3827457 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGACGAACCTAACACCGATGATCATCTTTGATCACAGCCGTTACAGACTAAAAGTGTGGCGCAATAAAG
CACCGCTGGATGTGCTGGCCTTTACCGGGCAGGAAGCCTTAAGCCAGCCGTTTCGCTATGCCATTGAATT
CACCAGTGCGGAGAAAGGGATTGAACCGGCACAGATGCTGATGCAGCAAGCCTCATTTACCCTGACCTCG
CCTGCGATCAATCCGGGGATACGGTGGATGCCGATTGTGCCGCCGGAGCCGCTGCGCTCGGTTTACGGGG
TGATCAGCGGCTTTAAACTGCTCTCCACTTCGCGGGACGAAAGCCGTTACGAAGTGACGCTGGAGCCCCG
GCTGGCGCTGCTGGCGAGAAGCCATCAATACGCTATTTACCAAAAACTGTCCGTGCCGGAGATTGTGGAG
AAAATCCTGCGGGAGCGACATGGTTTTCGCGGGCAGGACTTCCTGTTCAGTCTGGCGTACAGCTACCCGA
GGCGGGAACAGGTGATGCAGTATGGCGAAGATGACCTGCGCTTTATCCAACGCATGCTGGCGGAAGTGGG
TATCTGGTACAAAGTGACGGCGGATGACCGGTTAAAGATCGATGTGGTGGAGTTTTACGACGACCAGCGT
GACTACCAGTTCAATGTCTACCTGCCTGCCCGCAATCCGTCAGGTATGCACGGCGAGGAGGACGCGGTGG
TGTGGGGCATGGAGACCGCGTATCAGGTGGTGGAGGGAAAAATTGCGACTCGGAATTATGACTACCACGA
TGCCCGGCCGTATCCCGGCTTGAACACCGAGGCGGATGTGACACGGGGCGATCGAACGACTTATGGCGAA
GCGTACCATTACCGTGACGACTACCGAATACCCGGTGATCGTTACGCCTATCAACCGGAGACGGAAAGCG
GGGTGTTTTATGCCCGTTTGCATCACGAACGTTACCTGAATCAACGCATCCGCCTGCGGGGAATGACCAC
CTCCGCCACGCTGGTGCCGGGACAGGAGTTGAAAGTGAAAGGTGACGCCCCGGAAACGTTTCGCAAAGGG
GCGATCATCACCCAGATCACCAACAGTGCCCGCCGGGACAGCAGTTTTGAGATGACATTCACTGCCATTC
CCTATTCCGAGACCGTGTGCTTTCGCCCGGAGCGGGTGCCGAAACCGGTGATGGCCGGCACGATACCCGC
GCGGGTGAGCAGTACCAAAGTGAATGATACCTACGGCGATATCGACAAAGACGGCTTATATCGGGTGGTG
TTTAATTTTGACCGGGAGAAATGGCCGCAAGGCGGCGAAAGCTTGTGGGTGCGTCTGGCGCGCCCGTATG
CGGGGGAGAACTATGGTTTTCACTGGCCGTTGCTGGAAGGCACCGAAGTCGCGATCGCCTTTGAAGGGGG
CGACCCGGACCGGCCCTATATTGCCCATGCTCTGCACGACTCAGTGCACCCGGATCACGTCAATCTCTAC
AACTACAAACGCAACGTTCTGCGCACCCCGGCGAATAACAAACTGCGGATGGATGACGAACGCGGTCGGG
AACATATCAAACTGAGTACCGAGTACGGCGGTAAAAGCCAGTTAAATCTCGGCCATCTCGTTGATAGCCA
GCGCCCACACCCGGATAAACGGGGAGAAGGCTTTGAGCTGCGAACCGACGACTGGGGCGCGATCCGGGCC
GGTAAGGGGTTGTTTATCAGTGCGGATAAACAGGCCCGCGCGGGCGGTGAAGTGCTGGAGATGGAGGCGG
CGCTGAATCAACTTCAACAAGCGCAGACCTTAACCGAGGCATTATACGGCGCGGCTGAAATGGCTAAAGC
GGAACTGGCGGATTTGCAGCAACAGAAGGCGCTGTTAAGTGAAACGTTAGCCGAGCTGAAAAAATCCGCG
TTGTTACTCTCCGCGCCAGAAGGGATCGCGCAGACGACGGCAAAAAGCCTCCAGTTGGCGGCCGGGGAAA
ATATTATCGTCACCAGTGGGAAAAGTACCGATTTCAGCGTATTGAAAAAATTCACGGTGGCGGCGGGTGA
AAGGATCAGCCTGTTTGCCCAAAAACTGGGCATCAAACTGTTTGCCAGCAAAGGCCGGGTAGATATTGAA
GCGCAGGGTGATGAGATGGGGCTGGCGGCACTGAAAGATATCACGGTGAATAGCCATGAGGGAAAAGTGA
TCATCAGCGCCAAACAGGAGATCTTGCTGGTCAGTGGCGGTGGTTATATCCGAATAGGAAATGGTCAGGT
GGAGTGTGGTGCGCCCAATCACATCATCCAACGGGCGGCAGTGTGGCAGAAGTTTGACGGGCAGAGTGTT
AGTCAGACAGTACAGCAATGGCAAACCGCGAATTATGCGGTAACGCCGAAGGCTGTACGGGCTTATAAGA
TTTCTCCGTTAGACCGTCAAAATATGCAGTTCCATGCCGAAGATGGCGGCGTACAGGCATTATCAACCAT
ACAGAATGGAAAAACCCCTTTGCAAAAGCAGGTTGGGGTGGAAATCAGTCAATTGAAAATAAAAGATGAG
GAGTAA