SecReT6
Protein ID: 37527129
SecReT6 ID52
T6SS typei2
Gene symbol-
Locus tagplu3246
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]3840506..3842905 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ7N251
KEGG IDplu:plu3246
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-56, Aligned region: 34..361
DUF2345 [PF10106], Evalue: 2.70E-41, Aligned region: 621..767
T6SS_Vgr [PF13296], Evalue: 2.30E-35, Aligned region: 494..595
Phage_base_V [PF04717], Evalue: 1.60E-18, Aligned region: 399..487
Protein Sequence: 799 a.a.     [Download]
>gi|37527129|ref|NP_930473.1| hypothetical protein plu3246 [Photorhabdus luminescens subsp. laumondii TTO1]
MTNLTPMIIFDHSRYRLKVWRNKAPLDVLAFTGQEALSQPFRYAIEFTSAEKGIEPAQMLMQQASFTLTS
PAINPGIRWMPIVPPEPLRSVYGVISGFKLLSTSRDESRYEVTLEPRLALLARSHQYAIYQKLSVPEIVE
KILRERHGFRGQDFLFSLAYSYPRREQVMQYGEDDLRFIQRLLAEVGIWYKVTADDRLKIDVVEFYDDQR
DYQFNVYLPARNPSGMHGEEDAVVWGMETAYQVVEGKIATRNYDYHDARPYPGLNTEADVTRGDRTTYGE
AYHYRDDYRIPGDRYAYQPEAESGVFYARLHHERYLNQRIRLRGMTTSATLVPGQELKVKGDAPETFRKG
AIITHITNSARRDSSFEMTFTAIPYSETVCFRPERVPKPVMAGTIPARVSSTKVNDTYGDIDKDGLYRVA
FNFDREKWPQGGESLWVRLARPYAGENYGFHWPLLEGTEVAIAFEGGDPDRPYIAHALHDSVHPDHVNLY
NYKRNVLRTPANNKLRMDDERGREHIKLSTEYGGKSQLNLGHLVDSQRPHPDKRGEGFELRTDDWGAIRA
GKGLFISADKQARAGGEVLEMAPAISLVKGAVNQVLEWGTVTKTHLNHQPDTESLKTYLQHVDQLKMAAM
LLSAPEGVGIVSPQTVMVQSGQALYAQSAGDVHIASANRIGMNSIQAISLLAQNEGMRLVSGKGPLAIES
HGDSLGLTSLNDVTVNSTQGHVQITAKNGLTLACGGAYIRLSPAGEIEIHGPGLLSLKGQHKMASPAKQD
FPLPDLPESVCKTCLEKAQELSQGFVLRS
 
Nucleotide Sequence: 2400 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c3842905-3840506 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGACGAACCTAACACCGATGATCATCTTTGATCACAGCCGTTACAGACTAAAAGTGTGGCGTAATAAAG
CACCGCTGGATGTGCTGGCCTTTACCGGACAGGAAGCCTTAAGCCAGCCGTTTCGCTATGCCATTGAATT
CACCAGTGCGGAGAAAGGGATTGAACCGGCACAGATGCTGATGCAGCAAGCCTCATTTACCCTGACCTCG
CCTGCGATCAATCCGGGGATACGGTGGATGCCGATTGTGCCGCCGGAGCCGCTGCGTTCGGTTTACGGGG
TGATCAGCGGCTTTAAACTGCTCTCCACTTCGCGGGACGAAAGCCGTTACGAAGTGACGCTGGAGCCCCG
GCTGGCGCTGCTGGCGAGAAGCCATCAATACGCTATTTACCAAAAACTGTCCGTGCCGGAGATTGTGGAG
AAAATCCTGCGGGAGCGACATGGTTTTCGCGGGCAGGACTTCCTGTTCAGTCTGGCGTACAGCTACCCGA
GGCGGGAACAGGTGATGCAGTATGGCGAAGATGACCTGCGCTTTATCCAACGCCTGCTGGCGGAAGTGGG
TATCTGGTACAAAGTGACGGCGGATGACCGGTTAAAGATCGATGTGGTGGAGTTTTACGACGACCAGCGT
GACTACCAGTTCAATGTCTACCTGCCTGCCCGCAATCCGTCAGGTATGCACGGCGAGGAGGACGCGGTGG
TGTGGGGCATGGAGACCGCGTATCAGGTGGTGGAGGGAAAAATTGCGACTCGGAATTATGACTACCACGA
TGCCCGGCCGTATCCCGGCTTGAACACCGAGGCGGATGTGACACGGGGCGATCGAACGACTTATGGCGAA
GCGTACCATTACCGTGACGACTACCGAATACCCGGTGATCGTTACGCCTATCAACCGGAGGCGGAAAGTG
GGGTGTTTTATGCCCGTTTGCATCACGAACGTTACCTGAATCAACGCATTCGCCTGCGGGGAATGACCAC
TTCCGCTACGCTGGTGCCGGGGCAGGAATTGAAAGTGAAAGGTGACGCCCCGGAAACGTTTCGCAAAGGG
GCGATCATCACCCACATCACCAACAGTGCCCGCCGGGACAGCAGTTTTGAGATGACATTCACTGCCATTC
CCTATTCCGAGACCGTGTGCTTTCGCCCGGAGCGGGTGCCGAAACCGGTGATGGCCGGCACGATACCCGC
GCGGGTGAGCAGTACCAAAGTGAATGATACCTACGGCGATATCGACAAAGACGGCTTATATCGGGTGGCG
TTTAATTTTGACCGGGAGAAATGGCCGCAAGGCGGCGAAAGCTTGTGGGTGCGTCTGGCGCGCCCGTATG
CGGGAGAGAACTATGGCTTTCACTGGCCGTTGCTGGAAGGCACTGAAGTGGCGATCGCCTTTGAAGGGGG
CGACCCGGACCGGCCCTATATTGCCCATGCTCTGCACGACTCAGTGCACCCGGATCACGTCAATCTCTAC
AACTACAAACGCAACGTTCTGCGCACCCCGGCGAATAACAAACTGCGGATGGATGACGAGCGCGGTCGGG
AACATATCAAACTGAGTACCGAATACGGCGGTAAAAGCCAGTTGAACCTCGGTCATCTCGTTGATAGCCA
GCGCCCACACCCGGATAAACGGGGTGAAGGCTTTGAGCTGCGAACCGACGACTGGGGCGCGATCCGGGCC
GGTAAGGGGTTGTTTATCAGTGCGGATAAACAGGCCCGGGCGGGCGGTGAAGTGCTGGAGATGGCCCCGG
CAATCAGTCTGGTAAAAGGTGCGGTGAATCAGGTGCTGGAGTGGGGAACAGTGACCAAAACTCACCTGAA
TCATCAGCCGGATACTGAAAGCCTGAAAACCTACTTACAGCATGTGGATCAACTGAAAATGGCGGCCATG
CTGCTCAGTGCGCCGGAAGGGGTGGGGATTGTCAGCCCGCAGACTGTGATGGTGCAAAGTGGTCAGGCGC
TCTATGCCCAAAGTGCGGGGGATGTGCATATTGCCAGTGCAAACCGGATTGGGATGAATTCGATACAGGC
TATCTCCCTGTTAGCACAAAACGAAGGGATGCGTCTGGTGTCAGGGAAAGGGCCGCTCGCCATTGAATCA
CATGGCGATAGTTTAGGTCTCACCTCATTAAACGATGTCACCGTCAATTCAACACAGGGTCACGTCCAGA
TTACGGCGAAAAATGGCCTGACATTGGCGTGTGGAGGCGCGTACATCCGTCTTTCTCCGGCAGGAGAAAT
TGAAATTCACGGGCCGGGCCTGTTAAGCCTGAAAGGGCAGCACAAAATGGCGTCACCGGCGAAACAGGAC
TTTCCTTTGCCTGACCTGCCTGAATCGGTGTGTAAAACGTGTTTGGAAAAAGCGCAGGAATTGTCGCAGG
GGTTTGTTTTGAGGAGTTAA