SecReT6
Protein ID: 37527136
SecReT6 ID52
T6SS typei2
Gene symbol-
Locus tagplu3253
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]3852594..3855122 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ7N245
KEGG IDplu:plu3253
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-56, Aligned region: 34..361
DUF2345 [PF10106], Evalue: 8.40E-48, Aligned region: 619..769
T6SS_Vgr [PF13296], Evalue: 1.50E-38, Aligned region: 494..602
Phage_base_V [PF04717], Evalue: 1.80E-18, Aligned region: 399..487
Protein Sequence: 842 a.a.     [Download]
>gi|37527136|ref|NP_930480.1| hypothetical protein plu3253 [Photorhabdus luminescens subsp. laumondii TTO1]
MTNLTPMIIFDHSRYRLKVWRNKAPLDVLAFTGQEALSQPFRYAIEFTSAEKGIEPAQMLMQQASFTLTS
PAINPGIRWMPVVPPEPLRSVYGVISGFKLLSTSRDESRYEVTLEPRLALLARSHQYAIYQKLSVPEIVE
KILRERHGFRGQDFLFSLAYSYPRREQVMQYGEDDLRFIQRLLAEVGIWYKVTADDRLKIDVVEFYDDQR
DYQFNVYLPARNPSGMHGEEDAVVWGMETAYQVVEGKITTRNYDYHDARPYPGLNTEEDVTRGDRTTYGE
AYHYRDDYRIPGDRYAYQPETESGVFYARLHHERYLNQRIRLRGMTTSATLVPGQELKVKGDAPETFRKG
AIITHITNSARRDSSFEMTFTAIPYSETVCFRPERVPKPVMAGTIPARVSSTKVNDTYGDIDKDGLYRVA
FNFDREKWPQGGESLWVRLARPYAGENYGFHWPLLEGTEVAIAFEGGDPDRPYIAHALHDSVHPDHVNLY
NYKRNVLRTPANNKLRMDDERGREHIKLSTEYGGKSQLNLGHLVDSQRPHPDKRGEGFELRTDDWGAIRA
GKGLFISADKQARAGGEVLAMEAALNQLQQAQTLTEALCGAAEMAKAELADLQQQKALLSETLAELKKSA
LLLSAPEGIAQTTAKSLQLAAGENIIATSGKSTDFSVLKKFTVAAGERISLFAQKLGIKLFASKGRVEIE
AQGDEMGLAALKDITVNSHEGKVIISAKQEILLVSGGGYIRIGNGQVECGAPNHIIQRAAVWQKFGGQSV
SQMVSQRETVDFSVTPQVLWPFDDMPVKDQHAFLHNHDDSQHSSITGADGKTAKQKKLGVEAIKFYLKEG
KE
 
Nucleotide Sequence: 2529 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c3855122-3852594 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGACGAACCTAACACCGATGATCATCTTTGATCACAGCCGTTACAGACTAAAAGTGTGGCGCAATAAAG
CACCGCTGGATGTGCTGGCCTTTACCGGACAGGAAGCCTTAAGCCAGCCGTTTCGCTATGCCATTGAATT
CACCAGTGCGGAGAAAGGGATTGAACCGGCACAGATGCTGATGCAGCAAGCCTCATTTACCCTGACCTCG
CCTGCGATCAATCCGGGGATACGGTGGATGCCGGTTGTGCCGCCGGAGCCGCTGCGCTCGGTTTACGGGG
TGATCAGCGGCTTTAAACTGCTCTCCACTTCGCGGGACGAAAGCCGTTACGAAGTGACGCTGGAGCCCCG
GCTGGCGCTGCTGGCGAGAAGCCATCAATACGCTATTTACCAAAAACTGTCCGTGCCGGAGATTGTGGAG
AAAATCCTGCGGGAGCGACATGGTTTTCGCGGGCAGGACTTCCTGTTCAGTCTGGCGTACAGCTACCCGA
GGCGGGAACAGGTGATGCAGTATGGCGAAGATGACCTGCGCTTTATCCAACGCCTGCTGGCGGAAGTGGG
TATCTGGTACAAAGTGACGGCGGATGACCGGTTAAAGATCGATGTGGTGGAGTTTTACGACGACCAGCGT
GACTACCAGTTCAATGTCTACCTGCCTGCCCGCAATCCGTCAGGTATGCACGGCGAGGAGGACGCGGTGG
TGTGGGGCATGGAGACCGCGTATCAGGTGGTGGAGGGGAAAATTACGACTCGGAATTATGACTACCACGA
TGCCCGGCCGTATCCCGGCTTGAACACCGAGGAGGATGTGACACGGGGCGATCGAACGACTTATGGCGAA
GCGTACCATTACCGTGACGACTACCGAATACCCGGTGATCGTTACGCCTATCAACCGGAGACGGAAAGCG
GGGTGTTTTATGCCCGTTTGCATCACGAACGTTACCTGAATCAACGTATTCGCCTGCGGGGAATGACCAC
TTCCGCTACGCTGGTGCCGGGGCAGGAGTTGAAAGTGAAAGGTGACGCCCCGGAAACGTTTCGCAAAGGG
GCGATCATCACCCACATCACCAACAGTGCCCGCCGGGACAGCAGTTTTGAGATGACATTCACGGCCATTC
CCTATTCCGAGACCGTGTGCTTTCGCCCGGAGCGGGTGCCGAAACCGGTGATGGCCGGCACGATACCCGC
GCGGGTGAGCAGTACCAAAGTGAATGATACCTACGGCGATATCGACAAAGACGGCTTATATCGGGTGGCG
TTTAACTTTGACCGGGAGAAATGGCCGCAAGGCGGCGAAAGCTTGTGGGTGCGTCTGGCGCGCCCGTATG
CGGGAGAGAACTATGGCTTTCACTGGCCGTTGCTGGAAGGCACTGAAGTGGCGATCGCCTTTGAAGGGGG
CGACCCGGACCGGCCCTATATCGCCCACGCGTTGCACGACTCAGTGCACCCGGATCACGTCAATCTCTAC
AACTACAAACGCAACGTTCTGCGCACTCCGGCGAATAACAAACTGCGGATGGATGACGAACGCGGTCGGG
AACATATCAAACTGAGTACCGAGTACGGCGGTAAAAGCCAGTTGAACCTCGGTCATCTCGTTGATAGCCA
GCGCCCACACCCAGATAAACGGGGAGAAGGCTTTGAGCTGCGAACCGACGACTGGGGAGCAATCCGGGCC
GGTAAGGGGTTGTTTATCAGTGCGGATAAACAGGCCCGGGCGGGCGGCGAGGTGCTGGCGATGGAGGCGG
CGCTGAATCAACTTCAACAAGCGCAGACCTTAACCGAGGCATTATGCGGCGCGGCTGAAATGGCTAAAGC
GGAACTGGCGGATTTGCAGCAACAGAAGGCGTTGTTAAGTGAAACATTAGCCGAGCTGAAAAAATCCGCG
TTGTTACTCTCCGCGCCAGAAGGGATCGCGCAGACGACGGCAAAAAGCCTCCAGTTGGCGGCCGGGGAAA
ATATTATCGCCACCAGTGGGAAAAGTACCGATTTCAGCGTATTGAAAAAATTCACGGTAGCGGCAGGTGA
AAGGATCAGCCTGTTTGCCCAAAAACTGGGCATCAAACTGTTTGCCAGCAAAGGCCGGGTAGAGATTGAA
GCGCAGGGTGATGAGATGGGGCTGGCGGCACTGAAAGATATCACGGTGAATAGCCATGAGGGCAAAGTGA
TCATCAGTGCTAAACAGGAGATTTTGTTGGTTAGTGGCGGTGGTTATATCCGAATAGGGAATGGTCAGGT
GGAGTGTGGTGCGCCCAATCACATCATCCAACGGGCGGCAGTGTGGCAGAAGTTTGGCGGGCAGAGTGTT
AGTCAGATGGTTTCCCAACGTGAAACAGTGGATTTTTCCGTCACACCGCAGGTGCTCTGGCCTTTTGATG
ATATGCCGGTGAAGGATCAACATGCCTTTTTGCACAATCATGACGATAGTCAGCACTCTTCGATAACGGG
TGCAGACGGTAAGACGGCTAAACAGAAGAAATTGGGTGTGGAAGCAATAAAGTTTTATTTAAAAGAAGGT
AAGGAGTGA