SecReT6
Protein ID: 37527142
SecReT6 ID52
T6SS typei2
Gene symbol-
Locus tagplu3260
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]3860551..3861900 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ7N242
KEGG IDplu:plu3260
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.60E-135, Aligned region: 18..446
Protein Sequence: 449 a.a.     [Download]
>gi|37527142|ref|NP_930486.1| hypothetical protein plu3260 [Photorhabdus luminescens subsp. laumondii TTO1]
MKIERPLWVTGTILSPQQFQQQARWEAYANESIARLGLAHPWGVLTAVFDQHTLALGQLKADHLCVRFAD
GSLIDTDQADRLPPVLELAAVLPTDAQQVTVLLALPYTYANGGNCLKPDERADRPVRYQQEWVPVQDEFS
DRSESMAVARYAISLRFDSMENGQYLTCPVARLLRDAQGKWIFDEQFVPPLLRLSAHAGSIARLDQLLTQ
LRAKQARLMAMRRESNERMADFAVADVSLFWLLNALNSYEPILSDFKAHPDVHPELFYREAVRLAGSLLT
FSLDHNASVIPRYQHDNLTAVFPPLFDLLRQLLEISLPSRMVTIELKKPSEQQWIATLHDARLCEAADFY
LSVRSSIPAHQLYTRFPLLCKAGAPDEVDRMISRSLTGIPLVALSHVPAAIPLRLENQYFALDLTHPAGK
AMLAAGSCAFYVPGVLGDIQLELFAVLRT
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c3861900-3860551 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAAAATTGAGCGCCCGCTATGGGTAACAGGAACCATCTTGTCTCCCCAACAGTTTCAGCAGCAGGCTC
GTTGGGAGGCATATGCCAATGAGTCGATTGCTCGTCTGGGACTGGCGCATCCTTGGGGCGTGCTGACCGC
GGTGTTTGATCAACACACCTTAGCGTTGGGGCAGTTGAAAGCGGATCACCTGTGTGTGCGTTTTGCCGAT
GGATCGCTGATTGACACCGATCAGGCCGATCGCCTACCGCCGGTGCTGGAATTGGCCGCCGTTTTGCCGA
CAGATGCGCAGCAGGTCACGGTCTTACTGGCATTGCCGTACACTTACGCCAATGGCGGTAACTGTCTTAA
ACCCGATGAACGCGCCGATCGTCCGGTGCGTTACCAGCAGGAGTGGGTACCGGTACAGGATGAATTCAGT
GATCGCAGTGAATCGATGGCGGTTGCTCGTTATGCGATATCGCTGCGTTTTGACAGCATGGAAAACGGTC
AATATCTCACCTGCCCGGTGGCGCGTCTGTTGCGCGATGCTCAAGGAAAATGGATTTTTGATGAGCAATT
TGTGCCGCCATTACTGCGTCTTAGCGCACATGCCGGTTCGATAGCTCGGCTCGATCAGTTGTTGACGCAG
TTACGCGCTAAACAGGCTCGATTGATGGCAATGCGCCGAGAGAGCAATGAGCGGATGGCGGATTTTGCGG
TGGCGGATGTGTCGTTGTTCTGGCTGCTTAATGCGCTTAACAGTTATGAACCGATATTGAGTGATTTTAA
GGCCCATCCAGATGTGCATCCAGAACTGTTCTACCGTGAAGCGGTAAGGCTGGCGGGCAGTCTGTTGACC
TTTTCACTGGACCATAACGCCAGCGTGATCCCGCGTTATCAGCACGATAATTTGACGGCGGTATTCCCGC
CGTTATTTGACTTGCTGAGACAATTGCTGGAGATCAGCTTGCCGTCGCGGATGGTGACGATTGAGTTGAA
GAAACCATCGGAACAGCAGTGGATAGCCACTCTCCACGATGCCCGTTTATGTGAAGCGGCGGATTTTTAT
CTCTCTGTCCGCTCTTCCATACCGGCACACCAGTTGTACACCCGGTTCCCGCTGTTATGTAAAGCCGGTG
CGCCGGATGAGGTTGATCGGATGATTAGCCGGTCATTAACCGGCATCCCCTTAGTCGCACTTAGCCATGT
CCCGGCCGCGATCCCGTTGCGGCTGGAGAACCAGTACTTTGCCCTTGATCTCACCCATCCGGCGGGCAAA
GCCATGCTGGCGGCAGGGAGCTGTGCTTTCTACGTGCCCGGAGTACTGGGCGATATTCAGCTTGAACTGT
TTGCGGTATTGAGGACATGA