SecReT6
Protein ID: 37527144
SecReT6 ID52
T6SS typei2
Gene symbol-
Locus tagplu3262
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]3863474..3863971 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ7N240
KEGG IDplu:plu3262
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.50E-54, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|37527144|ref|NP_930488.1| hypothetical protein plu3262 [Photorhabdus luminescens subsp. laumondii TTO1]
MTHSFQNEIPKSRINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEHLPLGERKKVAINKNNFDSVLAEF
SPAINLTVKNTLAGDGSEENIALIFRQIKDFEPEQIARQIPQLRALLSMRHLLRDLRSNLLDNTTFRREL
EHILQDQALSDELRAELAALAPKTI
 
Nucleotide Sequence: 498 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c3863971-3863474 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGACCCATAGTTTTCAAAACGAGATCCCTAAATCGCGTATTAATATCAAGTTAGATTTACATACAGGAG
GTGCGCAGAAAAAAGTTGAGCTGCCGCTGAAATTATTGGTCATGGGGGATTATAGCAACGGGCAGGAACA
TCTCCCTCTTGGGGAAAGAAAAAAAGTGGCTATCAATAAAAACAATTTTGATAGCGTACTGGCTGAATTC
AGTCCCGCGATTAACTTGACGGTCAAAAATACCTTGGCCGGAGATGGCAGCGAGGAGAATATCGCCCTTA
TTTTTCGGCAAATAAAAGACTTCGAGCCTGAACAAATTGCTCGTCAAATCCCGCAACTGCGGGCCCTGCT
TTCTATGCGCCATCTATTGCGCGATCTGAGATCTAACCTGCTCGATAACACCACCTTTCGCCGGGAACTG
GAACATATCCTCCAGGATCAAGCGTTAAGCGATGAGTTACGGGCTGAACTGGCCGCACTGGCACCAAAAA
CGATTTGA