SecReT6
Protein ID: 37528036
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4198
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4911700..4913079 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ7MZS6
KEGG IDplu:plu4198
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.30E-47, Aligned region: 154..182
DUF3702 [PF12486], Evalue: 1.30E-47, Aligned region: 310..454
ImpA-rel_N [PF06812], Evalue: 7.40E-20, Aligned region: 41..101
Protein Sequence: 459 a.a.     [Download]
>gi|37528036|ref|NP_931381.1| hypothetical protein plu4198 [Photorhabdus luminescens subsp. laumondii TTO1]
MTTISSGNTIHTGDDPRALPEFSALKEEIGKLNHPARPDVNWARVEQLCLSLFRLNGVELQSAAWYTLAR
AQRTGLAGIDEGFALIDGLVSHQWAQFWPQPTHARIEIFAWLVARLQQVLRTCVFSYIDLPLIYRVEKVL
EQLCEVLQRLELKHVSKLDSLRVQLHNSARRLECLEQEKGAVPVSLASAQSVGGNAILLPEEPPPPQLIY
VVQETISSVQPQVKVAQVLTTSRWKVWRGFVAGIVFCALVVTGGWLVDKMRQPSPLAEALLATTYPLPQT
LLPAQLAELHQSDNATLLSQLQDKTLDASRAQLTNLTTLPAFWPLSYGSQLLQQLRTLWPASQAVQDMQN
QWLHQREAAALPMQSLENYHLAQLRLQHLTERLDALDEKRGRYLTGSELKSMVFGIRQPLANTPPLEELL
RQLAEQKKSGTVSLALLMQINTRFNQLLNRYYLLLKVGE
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4913079-4911700 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGACTACAATATCATCCGGCAACACGATACATACCGGGGATGATCCACGTGCACTGCCGGAATTCAGTG
CACTGAAAGAAGAAATCGGTAAATTGAACCATCCGGCTCGACCTGATGTTAATTGGGCCAGAGTTGAACA
ACTTTGTCTGTCGTTGTTTCGATTAAATGGCGTAGAGCTACAAAGTGCCGCTTGGTACACGTTAGCCCGA
GCTCAGCGCACCGGATTAGCCGGTATTGATGAAGGATTCGCATTGATTGATGGATTAGTGAGCCATCAAT
GGGCGCAGTTCTGGCCTCAGCCGACGCATGCACGGATTGAAATTTTCGCTTGGCTGGTTGCACGCTTACA
GCAGGTATTGCGTACTTGCGTCTTCTCTTATATTGACTTGCCGCTCATTTACCGGGTGGAAAAGGTGCTT
GAGCAACTGTGCGAGGTGCTTCAACGTCTGGAGCTGAAACATGTGAGTAAACTTGACAGCCTACGTGTAC
AGCTTCACAACAGCGCCCGGCGATTAGAGTGTCTGGAGCAGGAAAAGGGCGCGGTACCGGTATCTCTCGC
TTCGGCGCAGTCTGTTGGGGGCAATGCTATTTTGCTGCCTGAAGAACCCCCTCCGCCGCAACTGATCTAT
GTGGTGCAGGAGACAATCTCGTCGGTGCAACCGCAAGTCAAAGTTGCTCAGGTTTTGACGACTTCGCGCT
GGAAAGTTTGGCGAGGTTTTGTGGCGGGGATTGTATTTTGTGCGTTGGTGGTGACAGGCGGTTGGCTGGT
GGACAAGATGCGACAACCGTCTCCATTAGCTGAGGCTTTGTTGGCAACGACCTATCCATTACCGCAGACA
CTGCTTCCGGCTCAACTTGCCGAATTACACCAATCGGACAATGCGACGCTACTGAGCCAGTTACAGGATA
AAACGTTGGATGCGAGTCGTGCGCAACTGACAAATTTAACCACTTTGCCAGCCTTTTGGCCTTTGAGTTA
TGGTTCTCAGTTATTACAACAGCTACGTACATTGTGGCCGGCCAGCCAAGCAGTACAGGATATGCAAAAT
CAATGGTTACACCAGCGTGAGGCGGCGGCACTGCCGATGCAGTCATTGGAAAATTACCATCTAGCTCAAT
TACGCCTGCAACATCTGACAGAACGACTTGATGCATTGGATGAAAAACGCGGTCGTTATCTCACCGGTTC
TGAATTGAAGTCTATGGTGTTTGGCATTCGGCAGCCGTTGGCGAATACTCCGCCATTAGAGGAGTTGCTG
CGTCAACTGGCGGAACAAAAAAAGAGTGGTACCGTATCGCTGGCATTACTGATGCAAATTAACACCCGTT
TTAATCAATTGCTGAATCGCTATTATTTGTTGCTGAAAGTAGGAGAGTAG