SecReT6
Protein ID: 37528037
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4199
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4913131..4913565 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ7MZS5
KEGG IDplu:plu4199
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.80E-16, Aligned region: 29..115
Protein Sequence: 144 a.a.     [Download]
>gi|37528037|ref|NP_931382.1| hypothetical protein plu4199 [Photorhabdus luminescens subsp. laumondii TTO1]
MKQLRPSLYEMLMFNFNGGLDLNQIDERNQVILSVMDNMQRILSSRAGSLAHLPDYGLPDFNVILQGLPA
SSQSLIATIEHTLLTYEPRLKRVYITLLPQIEPGHLRYDINAELKDIGLVRFSTEFIPEGKVLIRHLRQQ
GHIE
 
Nucleotide Sequence: 435 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4913565-4913131 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAAACAGCTAAGACCTTCGCTTTACGAAATGTTGATGTTTAACTTTAACGGTGGGCTGGATCTCAATC
AGATCGATGAACGAAATCAAGTGATTTTATCCGTGATGGATAATATGCAACGTATCCTGAGCAGTCGAGC
GGGTTCGCTGGCTCATTTACCGGATTATGGTCTGCCCGATTTCAACGTCATTTTGCAAGGGCTGCCCGCG
TCGTCACAGAGTCTGATTGCCACAATCGAACACACGTTGTTGACCTATGAACCGCGTTTGAAACGAGTCT
ATATCACGCTACTACCGCAAATTGAACCGGGGCATCTGCGGTATGACATTAACGCTGAGCTAAAAGACAT
AGGATTAGTGCGGTTTAGTACGGAATTTATCCCGGAAGGGAAGGTATTAATCCGCCATTTACGTCAACAA
GGCCATATAGAGTAA