SecReT6
Protein ID: 37528038
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4200
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4913569..4914105 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ7MZS4
KEGG IDplu:plu4200
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-36, Aligned region: 22..169
Protein Sequence: 178 a.a.     [Download]
>gi|37528038|ref|NP_931383.1| hypothetical protein plu4200 [Photorhabdus luminescens subsp. laumondii TTO1]
MAAINVKSVMMGGIVCLMLQGLVGCGLTQTVTDGTVAVTQSIFHKQVKTLRLDFSARSALNTTDAQTPLS
TVVRVYQLKDNKAFKRASYADLLKGDSEALKADRLTQRDIRVAPKGSVSLDMPMEKAARFVGVVGLFHTP
DATNNSWRLVIRRDELDADKPRTIELGSGTLTLNAVKE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4914105-4913569 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGGCAGCTATCAATGTTAAATCCGTCATGATGGGCGGCATCGTTTGTCTGATGTTGCAGGGATTAGTCG
GATGTGGTCTGACGCAGACCGTAACTGACGGCACGGTAGCCGTGACGCAATCCATTTTCCATAAGCAGGT
GAAAACGCTGCGTTTGGATTTCAGTGCCCGCAGTGCGCTTAACACCACCGACGCGCAAACCCCGTTGAGC
ACGGTAGTGCGTGTTTATCAGCTTAAAGACAATAAAGCATTTAAGCGTGCCAGTTATGCGGACCTGTTGA
AAGGTGATAGTGAAGCGCTGAAGGCGGATCGGCTGACACAGCGGGATATCAGAGTGGCACCGAAGGGGAG
TGTGTCGCTGGATATGCCGATGGAGAAAGCGGCACGGTTTGTTGGGGTTGTGGGGCTGTTTCATACACCG
GATGCCACCAATAATAGTTGGCGGTTAGTGATCCGACGTGATGAGTTGGATGCAGATAAACCGCGCACGA
TCGAGTTGGGTAGTGGCACACTGACACTGAATGCGGTGAAGGAGTGA