SecReT6
Protein ID: 37528039
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4201
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4914086..4915126 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ7MZS3
KEGG IDplu:plu4201
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.90E-83, Aligned region: 7..308
Protein Sequence: 346 a.a.     [Download]
>gi|37528039|ref|NP_931384.1| hypothetical protein plu4201 [Photorhabdus luminescens subsp. laumondii TTO1]
MQQLAPNIYDFNFYRFCQLLESMRDGCPPLGSTMSPGDDPIRFRPDPGMGFPAGELKNVEWDEQQPEQPP
TVRTTFLGLYGVDSPLPTAYLNDIVQLSEGYEGVADFLDIFNHRMMTQYYRIWRKYSYPATYEPSGQDQT
SQCLLGLIGLGIAGSQQHIATPASRFLALLSIMRLPTRIAEGVMALVKLLAPLTQVQVVPHDCRRVRLTQ
PARLTRHHPVQLSQRPVLGKVGTDVNSQMVLDLYTEDTDEAQGWLPQGELHTDLLVLLRVYLGWRCSVRL
QLTLPKWVLPSAQLGKQRVRLGRTGILGLKPGSQTVSGMVKINLGHYQGLLPSYQYREAENGSYQC
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4915126-4914086 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGCAGCAACTGGCACCGAATATTTACGATTTTAACTTTTATCGCTTCTGTCAGTTGCTGGAGAGTATGC
GGGATGGGTGCCCGCCGTTGGGCAGTACGATGTCGCCCGGTGATGATCCGATCCGTTTCCGGCCTGATCC
CGGTATGGGTTTTCCTGCCGGTGAACTGAAAAATGTGGAGTGGGATGAGCAACAGCCTGAACAGCCACCG
ACAGTACGCACGACGTTTCTCGGCTTGTATGGTGTGGATTCACCGCTGCCGACGGCTTATCTGAATGATA
TCGTTCAGCTGAGTGAAGGCTATGAAGGCGTAGCAGACTTTCTGGATATTTTTAACCATCGAATGATGAC
CCAGTATTACCGTATCTGGCGTAAATATTCCTATCCCGCGACTTATGAACCGAGTGGTCAAGATCAAACC
TCGCAATGCCTGCTTGGGCTGATTGGTTTGGGGATCGCCGGTAGCCAGCAACATATTGCTACGCCGGCTT
CTCGCTTTCTGGCGCTGCTCAGTATCATGCGGCTGCCAACCCGGATAGCCGAAGGGGTGATGGCGCTGGT
TAAGCTATTGGCCCCTCTCACGCAAGTACAGGTGGTTCCCCATGATTGCAGACGAGTACGGTTGACCCAA
CCGGCTCGCTTAACTCGTCACCATCCGGTTCAGCTTTCTCAACGTCCAGTACTGGGCAAAGTCGGGACGG
ATGTTAACAGCCAAATGGTGCTGGATCTCTATACCGAAGATACTGATGAAGCTCAAGGGTGGTTACCACA
GGGGGAACTGCATACCGACCTGTTGGTGTTGCTACGCGTTTATCTGGGTTGGCGTTGCAGCGTGCGATTA
CAGCTCACTTTACCCAAATGGGTATTGCCATCGGCGCAACTAGGGAAACAACGCGTTCGGTTAGGTCGAA
CAGGCATATTGGGATTGAAACCGGGCTCACAAACGGTTTCAGGCATGGTGAAAATTAATCTGGGGCACTA
TCAAGGGCTCTTACCGAGTTATCAATATAGGGAGGCCGAGAATGGCAGCTATCAATGTTAA