SecReT6
Protein ID: 37528040
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4202
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4915126..4916892 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ7MZS2
KEGG IDplu:plu4202
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.20E-190, Aligned region: 6..585
Protein Sequence: 588 a.a.     [Download]
>gi|37528040|ref|NP_931385.1| hypothetical protein plu4202 [Photorhabdus luminescens subsp. laumondii TTO1]
MDDLILRYYEAEMQYLREAGKEFAQAHPDRAAMLNLSDDRDLDPYVERLLEGFAFLIGRMRQKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSIVELAPDYQTLPKSEVIAKGFEVISQPVGPSQTRCYYRTTRDIQITPLH
ITSATLQNEADGRSVIRLRFDCGQLTEWDKVDLARLPLYLKAGRPVSSALHLALTRQTQQIYARLSSQEE
RSRLKNGCFSPMGFDNDDVLWPKQESAFSGYQLLLEYFTFREKFMFVALNGLDSLEIPTGTPWFELDIVL
SELWPYELKFSAENIRLHCVPVINLFRVEADPMHISRLQNEYLLRPMRIQDGHTEIYSVDEVSSSRRGDA
QRFVPFSSFRHRGGIMRSSAPERYFHTRVCRGPSGLHDTWLILGGESFETDPELDDETLSLRITGTNGQL
PRQALRNTQLEQTLHSAAGTLRVSNLCSPTLPCYPPANDRFHWRILSHLGSNFLSMMDNPEVLRGTLGLY
NWTNDEMNCRCLDAIVGVKHALIERFEKGFLLRGVDIEITLNSNGFAGEGDIFLFGELLNRFFSLYTDIH
LFNQLTLILQPSGRCLRWQENHNQRIPG
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4916892-4915126 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGGATGATTTAATTCTCCGCTATTACGAAGCGGAAATGCAATATCTGCGTGAAGCTGGCAAAGAGTTTG
CGCAGGCGCACCCGGACCGGGCAGCTATGCTGAATCTGAGTGACGATCGGGATCTTGATCCTTATGTGGA
GCGATTGCTTGAAGGCTTCGCTTTCCTGATAGGGCGGATGCGTCAGAAACTTGATGATGATTTGCCGGAA
CTGACGGAAGGGTTGGTGAGTTTGCTGTGGCCGCATTATCTACGCACTATTCCTTCACTCTCCATTGTTG
AATTGGCACCTGATTATCAGACCTTGCCAAAAAGTGAAGTGATCGCCAAAGGGTTTGAAGTGATATCTCA
GCCCGTAGGACCAAGCCAGACCCGCTGCTATTACCGGACTACCCGTGATATACAGATTACACCGCTGCAT
ATCACCTCTGCGACGTTGCAAAATGAAGCCGACGGCCGTTCAGTGATCCGTTTGCGTTTTGACTGCGGTC
AGTTGACCGAGTGGGATAAAGTGGATTTGGCACGTCTGCCTCTGTATCTCAAAGCGGGCCGTCCGGTGAG
TTCTGCCTTACATCTGGCGTTGACCCGACAGACTCAACAGATTTACGCGCGCTTATCCAGTCAGGAAGAG
CGCTCTCGCCTTAAGAATGGCTGTTTTTCCCCGATGGGGTTCGACAATGATGATGTTCTGTGGCCGAAAC
AGGAGAGCGCGTTCAGTGGTTATCAGTTGTTACTGGAATATTTTACTTTCCGTGAAAAATTTATGTTTGT
GGCGCTCAATGGCTTGGATTCGTTAGAGATTCCTACCGGTACGCCTTGGTTTGAGTTGGATATCGTACTC
AGTGAATTGTGGCCCTATGAATTGAAGTTTTCAGCGGAAAATATCCGATTGCATTGCGTGCCGGTAATCA
ATTTATTCCGTGTTGAAGCTGATCCGATGCACATTTCGCGGCTGCAAAATGAGTATCTACTGCGCCCGAT
GCGCATTCAGGATGGTCATACCGAAATCTATTCGGTGGATGAAGTCTCCTCTTCCCGCCGAGGTGATGCT
CAGCGTTTTGTACCGTTTAGCAGCTTTCGTCATCGGGGCGGCATCATGCGTAGTTCCGCACCGGAGCGTT
ATTTTCATACGCGCGTCTGTCGAGGTCCTTCGGGTTTGCACGATACCTGGCTGATCCTCGGTGGAGAATC
GTTTGAAACTGACCCAGAGCTTGATGATGAAACCCTTTCACTGCGTATCACCGGAACCAACGGCCAGTTA
CCTCGTCAGGCATTACGTAATACCCAACTTGAACAGACACTACACTCCGCCGCGGGCACGCTGCGCGTAA
GCAATCTCTGTTCGCCGACGTTGCCCTGTTATCCCCCAGCGAACGACCGTTTCCACTGGCGGATATTAAG
CCATCTCGGTTCTAATTTTCTTAGCATGATGGATAACCCGGAGGTGCTGCGCGGCACGTTAGGGCTTTAT
AACTGGACAAATGATGAGATGAACTGCCGCTGTCTGGATGCCATTGTTGGGGTGAAACACGCTTTGATCG
AACGTTTTGAAAAGGGCTTCCTACTCCGGGGCGTTGATATTGAGATTACGCTGAACAGCAATGGCTTTGC
CGGCGAAGGCGATATTTTCCTGTTCGGTGAGCTGCTTAACCGCTTCTTCTCGCTGTATACCGATATTCAT
CTGTTTAACCAATTGACACTGATCCTTCAACCTTCTGGGAGATGTTTGCGATGGCAAGAAAATCACAATC
AGCGTATTCCCGGTTAA