SecReT6
Protein ID: 37528041
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4203
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4916971..4918569 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ7MZS1
KEGG IDplu:plu4203
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.00E-20, Aligned region: 63..123
ImpA-rel_N [PF06812], Evalue: 4.00E-20, Aligned region: 300..336
Protein Sequence: 532 a.a.     [Download]
>gi|37528041|ref|NP_931386.1| hypothetical protein plu4203 [Photorhabdus luminescens subsp. laumondii TTO1]
MLQQLIESCFVERDVLAEARQNAARWENWLLPISTDAPTGNDPVYEDDFQCMREEVNKISGVDTSLICQL
AEKLLTTKCKDVRVATYYVWARLHCEGEHGLAEGLALLAGLADRFGEALLPSRASSRKAALEWLTGAKMR
DSLSRYPEVNRTDFDHILAALVLLEQSFSSWDEESRPSLVGLARTLENRLAQSGGVSAVVPQTAAPVLPS
AGQSKASASGKSPVWRQVQSGRDLLDQARELVRYLRDQPQGWLSSARLIRSIRWDTVHQLPPQDADERTR
LVPPRTESRAQLKRLYRQQNWHELLEQAERMFAEGVNHFWLDLQWYLCQALSRLGCPYEGWADIMKHDLR
ILLERLPGLESMAYNDGTPFADEVTTSWIAQQVHDNQSDWQFEHLPAQPRHDDDVLALEAEALQLADSEG
IDAALRWLGQLPGINGARHRWLQRLLMARVAEQYGKNEMALHLLTELDADEQFNLGEWEPELMFEVKACL
LKLLRMKAQRSEHDKARMAQRMETLLAGLVAIDPVRASVLCG
 
Nucleotide Sequence: 1599 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4918569-4916971 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGCTGCAACAGCTAATTGAGAGTTGTTTTGTTGAACGTGATGTCCTTGCGGAAGCACGGCAGAACGCGG
CGCGGTGGGAAAACTGGTTGTTACCCATTAGTACCGATGCGCCTACAGGTAATGATCCGGTCTATGAAGA
CGATTTTCAGTGTATGCGGGAGGAGGTTAATAAAATCAGTGGTGTTGATACTTCCCTGATTTGTCAACTG
GCGGAGAAGTTGTTGACCACCAAATGCAAAGATGTCCGCGTGGCGACCTACTATGTGTGGGCCCGTCTGC
ATTGTGAGGGGGAACATGGTCTGGCAGAAGGGTTGGCGCTATTAGCCGGATTGGCGGATCGGTTTGGTGA
AGCCCTGTTACCCAGTCGGGCTAGCAGCCGGAAAGCGGCGCTGGAGTGGCTGACAGGTGCAAAAATGCGG
GACAGTTTATCACGCTATCCAGAGGTAAATCGGACCGATTTTGACCACATTCTGGCCGCGTTGGTGTTAC
TGGAACAGTCATTTTCCTCTTGGGATGAAGAATCTCGTCCAAGCTTGGTCGGGCTGGCAAGAACACTGGA
GAACCGATTAGCTCAGTCCGGTGGCGTGAGTGCGGTAGTGCCACAAACTGCCGCTCCGGTACTGCCATCG
GCGGGACAGAGCAAGGCATCAGCATCGGGTAAGTCACCGGTATGGCGTCAGGTGCAATCTGGGCGTGATC
TGCTGGATCAGGCGCGTGAACTGGTGCGTTATCTGCGTGATCAACCTCAGGGCTGGCTCTCTTCCGCCCG
GCTGATACGTAGTATCCGTTGGGATACCGTCCATCAACTACCACCACAGGATGCTGATGAGCGTACCCGT
CTGGTGCCTCCCCGCACTGAATCTCGCGCTCAGTTAAAGCGGCTCTACCGGCAACAGAACTGGCATGAGT
TATTGGAACAGGCCGAGCGCATGTTTGCCGAAGGGGTGAATCATTTTTGGCTGGATTTGCAATGGTACCT
CTGTCAGGCATTAAGCCGATTGGGCTGCCCTTACGAAGGTTGGGCGGACATCATGAAACACGATCTGAGA
ATACTGCTTGAGCGGCTGCCGGGGCTGGAGAGTATGGCCTATAACGATGGGACGCCCTTTGCTGATGAGG
TGACAACCAGTTGGATAGCCCAACAGGTGCATGACAATCAGTCAGATTGGCAGTTTGAGCATTTGCCGGC
GCAACCTCGACATGATGATGACGTTTTGGCGCTGGAAGCGGAGGCGCTGCAACTGGCGGACAGCGAAGGC
ATTGATGCGGCGTTGCGTTGGTTGGGGCAATTGCCCGGTATTAATGGAGCCCGTCACCGCTGGTTACAGC
GCTTGCTGATGGCGCGGGTCGCTGAGCAATACGGCAAAAATGAAATGGCGTTGCATTTGTTGACTGAGCT
TGATGCCGATGAGCAATTCAATCTTGGCGAATGGGAGCCGGAACTGATGTTTGAGGTGAAAGCATGTCTG
CTTAAGTTACTGCGCATGAAAGCTCAACGCAGTGAACATGATAAAGCGAGGATGGCGCAACGGATGGAGA
CGCTGCTGGCTGGATTGGTGGCGATTGATCCGGTCAGAGCTTCGGTGCTTTGCGGTTAA