SecReT6
Protein ID: 37528052
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4216
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4931721..4931996 [-]
Producthypothetical protein
NotePAAR
UniProt IDQ7MZR1
KEGG IDplu:plu4216
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.10E-19, Aligned region: 7..82
Protein Sequence: 91 a.a.     [Download]
>gi|37528052|ref|NP_931397.1| hypothetical protein plu4216 [Photorhabdus luminescens subsp. laumondii TTO1]
MMFEGVIRLGDKLSSGGEVISASSSIEIEGKRVALLNDLVSCPLKGHGINRIVKANSQCISDGKPVAFDK
ALCQCGCYVISSTTKAGIGES
 
Nucleotide Sequence: 276 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4931996-4931721 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGATGTTTGAAGGTGTTATTCGCCTGGGCGATAAGCTCAGTAGCGGCGGTGAAGTGATTTCCGCCTCCT
CTTCTATCGAAATTGAAGGTAAAAGAGTCGCATTATTAAATGATTTAGTCAGTTGTCCGCTGAAAGGGCA
TGGTATTAATCGTATTGTTAAAGCTAATTCTCAATGTATTTCTGATGGTAAACCGGTCGCATTTGATAAA
GCGCTTTGCCAATGCGGTTGTTATGTCATTTCCAGTACGACGAAAGCCGGAATAGGGGAATCATAA