SecReT6
Protein ID: 37528058
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4222
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4938603..4940981 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ7MZQ5
KEGG IDplu:plu4222
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-63, Aligned region: 44..355
Phage_GPD [PF05954], Evalue: 4.30E-63, Aligned region: 598..641
DUF2345 [PF10106], Evalue: 8.10E-43, Aligned region: 553..576
DUF2345 [PF10106], Evalue: 8.10E-43, Aligned region: 615..763
T6SS_Vgr [PF13296], Evalue: 9.30E-37, Aligned region: 489..597
Phage_base_V [PF04717], Evalue: 7.10E-19, Aligned region: 388..483
DUF3540 [PF12059], Evalue: 0.0042, Aligned region: 544..625
DUF3540 [PF12059], Evalue: 0.0042, Aligned region: 686..727
Protein Sequence: 792 a.a.     [Download]
>gi|37528058|ref|NP_931403.1| hypothetical protein plu4222 [Photorhabdus luminescens subsp. laumondii TTO1]
MMDRKMLRARQLKASQAVLPGHARYRLEVRRCHAELDVFSFTGEERLCAPYCYTIDFTSPTRDIDPAVML
NKSATFILQAPENPEQVRKVHGVITRFNRLTTSADETRYQVCLEPYLALLRHTRRCGIYQHQSVPEIVEK
ILRERHEFRGQDFLFTLVRDYPKRELVVQWQESDLDFIQRILAAVGIWYCFEMDSRLGIEVVRFGDNQRN
YQYDVRLPLRDPAGMNHNDRDSVWDLHVEHQVVTQGVKVRDYNYREAGNDLQYQVARDRDSTVVGEVYRY
GDNFLEKGEQIQPVPETAGFYARLHHERNLYQQHRISGKSSSPMLVPGLVLELDGERPAGVGKAGVLIVA
MHSSARRDSNYLVSFSGVPYSEVLSYRPALRERPVIAGTVPARVTSNWSNGTYSHIDTTGRYRVKFDFDL
DEWPLGGESLWVRLARPYAGKTHGFHWPLIQGTEVAIAFEQGDPDRPYIAYALHDSRHEDHVTLYNYKRN
VLRTPANNKLRMDDERGKEHIKLSTEYGGKSQLNLGHLVDGQRPHPNKRGEGFELRTDDWGTIRAGKGLF
ISADQQIKASGEQLDMQRALAELDAAFQTAAGLRHAAEAAKAELADIETQAAFMNETLKALQQRALLLSA
PSGIAQVTPGNLQFSAGENLITTVGCDADMSIMKKFRLAVGNGLSLFTRTLGLKLLAASGKVEIQAQTDA
IEVLAQQALTLASQQDRVTVSAKTELRLECGGAYISLKDGHISFAGPKNARFQCDILQKNGPVSQSSDLT
LPERCASTAERMMGNQDGVTKK
 
Nucleotide Sequence: 2379 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4940981-4938603 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGATGGATAGAAAAATGCTGCGCGCCCGTCAGCTTAAGGCGAGTCAAGCTGTGCTGCCGGGCCATGCCC
GCTACCGGCTTGAAGTCCGGCGCTGCCATGCTGAACTGGACGTATTCAGCTTCACCGGCGAAGAGCGCCT
GTGCGCCCCTTATTGCTATACCATTGATTTCACCAGCCCGACCCGGGATATCGACCCGGCGGTGATGTTG
AACAAATCCGCCACATTTATCTTGCAGGCACCGGAAAACCCGGAGCAGGTGCGTAAAGTACACGGCGTCA
TCACCCGTTTTAACCGGCTTACCACCTCGGCGGATGAAACGCGCTATCAGGTCTGTCTGGAGCCCTATCT
GGCGTTACTGCGCCACACCCGGCGCTGTGGGATTTACCAGCACCAGTCAGTGCCGGAGATTGTGGAAAAG
ATCCTGCGTGAACGACACGAATTTCGCGGGCAGGATTTTCTGTTCACGCTGGTGCGGGATTACCCGAAGC
GGGAACTGGTGGTGCAGTGGCAGGAGAGCGATCTGGACTTTATCCAGCGCATTCTGGCGGCCGTGGGGAT
CTGGTATTGCTTCGAGATGGACAGTCGTCTGGGGATTGAAGTGGTGCGGTTCGGGGATAACCAGCGCAAC
TATCAGTACGACGTGCGTTTACCGTTACGTGACCCGGCGGGCATGAATCACAACGATCGTGATTCGGTGT
GGGATTTGCACGTGGAACATCAGGTAGTGACGCAAGGTGTGAAGGTGCGGGACTACAACTACCGGGAAGC
AGGCAATGACCTGCAATATCAGGTGGCACGAGATCGGGATAGCACCGTGGTCGGTGAAGTATACCGCTAT
GGTGATAACTTTCTTGAAAAGGGAGAACAGATCCAACCGGTACCGGAAACCGCAGGATTTTATGCCCGTT
TACATCACGAGCGCAACCTGTACCAGCAGCACCGGATCAGCGGCAAAAGTTCCTCCCCGATGCTGGTCCC
CGGCTTAGTGCTGGAGCTCGACGGAGAGCGACCGGCAGGGGTAGGAAAAGCGGGGGTGTTGATTGTCGCC
ATGCACAGCAGCGCCCGGCGTGACAGCAACTATCTGGTCAGTTTTAGCGGTGTTCCGTACAGCGAAGTGT
TGAGTTACCGACCGGCGCTGCGGGAACGGCCGGTGATTGCCGGCACAGTTCCGGCGCGGGTGACCAGCAA
CTGGTCGAACGGCACCTACAGCCATATCGACACCACGGGTCGTTACCGCGTCAAATTTGATTTTGACCTG
GATGAATGGCCGTTGGGGGGAGAAAGCCTGTGGGTACGTTTAGCCCGCCCGTATGCCGGTAAAACTCACG
GTTTTCACTGGCCGCTGATTCAGGGAACCGAAGTGGCGATCGCGTTTGAGCAGGGGGATCCGGATCGGCC
CTACATCGCCTATGCGTTGCATGATTCCCGGCATGAAGATCATGTGACTCTCTACAACTACAAACGCAAC
GTGCTGCGCACACCGGCCAACAACAAACTGCGCATGGATGACGAGCGCGGCAAAGAGCACATCAAACTGA
GCACCGAATATGGCGGGAAAAGCCAGCTCAATCTCGGCCATCTGGTGGATGGACAGCGGCCCCATCCCAA
TAAGCGCGGCGAAGGGTTTGAGTTACGTACCGACGACTGGGGGACGATCCGGGCCGGGAAAGGGCTGTTT
ATCAGCGCCGATCAGCAGATTAAAGCCTCGGGCGAGCAATTAGATATGCAGCGGGCGCTGGCTGAACTGG
ATGCGGCGTTTCAGACCGCAGCGGGGTTGCGTCATGCCGCTGAGGCGGCGAAAGCGGAACTGGCTGATAT
TGAAACGCAGGCCGCTTTTATGAATGAAACCCTTAAAGCGTTGCAACAGCGAGCACTCTTACTTTCTGCG
CCCTCAGGTATTGCTCAGGTGACCCCGGGCAATTTGCAGTTCTCCGCCGGGGAGAACCTGATAACCACCG
TCGGTTGTGATGCGGATATGAGCATCATGAAGAAATTCCGGCTGGCGGTGGGGAATGGCCTGAGTTTGTT
CACCCGAACTTTGGGCCTAAAGCTGCTGGCGGCTTCCGGCAAGGTAGAGATTCAGGCACAGACTGACGCG
ATAGAGGTGCTGGCTCAACAGGCGCTGACACTGGCAAGTCAGCAGGATCGCGTGACCGTCTCGGCGAAAA
CGGAACTGCGTCTGGAGTGTGGCGGGGCTTATATCTCGCTGAAAGACGGGCATATTTCCTTTGCCGGCCC
TAAAAATGCCCGCTTCCAGTGTGACATTTTGCAGAAAAACGGCCCGGTGAGTCAGAGTTCAGACCTGACG
TTACCTGAGCGTTGTGCGTCAACGGCAGAGCGGATGATGGGTAATCAAGATGGTGTAACGAAAAAATGA