SecReT6
Protein ID: 37528060
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4224
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4943908..4945584 [-]
Producthypothetical protein
NoteTagL
UniProt IDQ7MZQ3, Q7MZQ3
KEGG IDplu:plu4224
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.10E-17, Aligned region: 442..538
Protein Sequence: 558 a.a.     [Download]
>gi|37528060|ref|NP_931405.1| hypothetical protein plu4224 [Photorhabdus luminescens subsp. laumondii TTO1]
MSCVLKRALWLLAGVLAALLCLFFFPLGNVSVALWLAVISMVAVMAWWWVRRTTLEISHQASVYRLLAAL
PAASWHQPVVLTCGDSVATLFAGELVRFTPQGCFICVPKQSEMSTLVEAIIAARPDWCRQISVLLTLFPE
QQWDHAVMAAKIREFRYQVDRVAQLTACHTPVLIASYLDGDISPWFELQADSATMTVWGEKHAAVGMNIW
LTEGDAQQRVARLQQTIVAAAWQRWMVENILNECRSQELVSRPCYPIAMALTFLPQTPQADSLWTKWLVD
RTTLPRISHSIAEAVNVSPFPDAMLRLLPHHVGHTPHRRAVIWGIGLLSGFTCLALASCAWNNLRLFRQI
RSDLQHYQVVGVKDSGAKVQAYHQLKRDATLLEKYQRDGEPVRLGLGLYLGDRLYTPLMTVINHAVLPVS
SPPVLKSGKPLPQTLNLSSMSLFDVGQSRLKPEAAKVLVNALIEIKAKPEWMVVITGHTDSTGDAVKNRE
LSLARAKAVRDWILQTSDVSPTCFVVKGEGATQPIATNTTAVGRAVNRRVEISLMPPSVIACQRPENH
 
Nucleotide Sequence: 1677 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4945584-4943908 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
TTGAGTTGCGTATTAAAACGAGCGTTGTGGCTTTTAGCGGGTGTTCTGGCGGCGCTGTTGTGTCTGTTTT
TCTTCCCGTTAGGGAATGTGTCAGTTGCATTGTGGTTGGCTGTGATCTCGATGGTAGCGGTGATGGCTTG
GTGGTGGGTGAGGCGTACCACACTTGAAATATCCCATCAGGCCAGTGTTTACCGTTTGCTGGCGGCATTG
CCCGCTGCTTCGTGGCACCAGCCTGTGGTGCTAACCTGCGGAGATAGCGTGGCAACCCTGTTTGCGGGAG
AACTTGTACGCTTCACGCCACAGGGCTGTTTTATCTGTGTGCCGAAACAAAGTGAGATGAGTACGCTGGT
AGAAGCGATTATTGCCGCCAGACCTGATTGGTGTAGGCAGATCAGCGTGTTATTAACACTCTTTCCTGAA
CAGCAATGGGATCACGCGGTGATGGCGGCAAAGATCAGGGAATTTCGCTATCAGGTTGATCGTGTTGCTC
AACTGACCGCTTGTCATACACCGGTATTGATCGCCAGCTATCTTGATGGCGATATCAGCCCGTGGTTCGA
GCTACAGGCAGATAGCGCGACAATGACGGTATGGGGAGAAAAACACGCCGCTGTTGGGATGAATATCTGG
TTGACCGAAGGAGATGCACAGCAACGCGTCGCACGTTTACAACAAACGATTGTGGCGGCGGCATGGCAAC
GCTGGATGGTAGAAAATATCTTGAACGAATGCCGATCCCAGGAGCTGGTCAGTCGGCCTTGTTACCCGAT
AGCAATGGCACTGACGTTTTTGCCACAAACGCCACAGGCAGACAGCTTATGGACAAAATGGCTGGTCGAT
CGTACCACTTTACCCCGCATTAGCCACAGCATTGCTGAGGCGGTGAACGTATCGCCATTTCCCGATGCCA
TGTTACGCCTGTTGCCACATCATGTTGGTCATACACCGCACCGACGAGCGGTCATCTGGGGCATCGGCCT
ACTGAGCGGATTTACCTGTCTGGCGTTGGCCTCCTGTGCCTGGAACAACTTGCGTCTGTTCCGCCAGATA
CGCAGTGATTTACAGCATTATCAGGTCGTTGGCGTGAAAGATAGTGGTGCAAAAGTTCAGGCTTACCATC
AACTTAAGCGTGATGCGACGTTGCTGGAAAAATATCAACGTGATGGCGAACCGGTGCGTTTAGGGTTAGG
GCTCTATTTAGGTGATCGCCTTTATACGCCACTGATGACTGTGATCAACCATGCGGTGTTACCGGTATCT
TCGCCTCCTGTACTGAAGAGTGGCAAGCCGTTGCCACAGACATTGAACCTGAGCAGCATGTCACTGTTTG
ACGTTGGACAGTCACGTCTTAAGCCAGAAGCAGCCAAAGTGTTGGTGAACGCATTGATCGAGATTAAAGC
TAAACCGGAGTGGATGGTGGTGATAACGGGTCATACTGATTCAACCGGTGATGCCGTAAAAAACCGCGAG
CTATCACTAGCGCGGGCAAAAGCAGTACGAGATTGGATATTACAAACCAGTGATGTATCGCCGACTTGCT
TTGTCGTAAAAGGTGAAGGAGCAACGCAGCCGATTGCCACCAATACAACCGCAGTGGGGCGTGCTGTTAA
TCGTAGGGTTGAAATCAGTCTGATGCCGCCGAGCGTGATCGCCTGCCAACGACCAGAAAATCACTAG