SecReT6
Protein ID: 37528061
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4225
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4945601..4946245 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ7MZQ2
KEGG IDplu:plu4225
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.20E-41, Aligned region: 7..207
Protein Sequence: 214 a.a.     [Download]
>gi|37528061|ref|NP_931406.1| hypothetical protein plu4225 [Photorhabdus luminescens subsp. laumondii TTO1]
MNKEISIDDLMLDIGMLVIALKSGDKSMYGEALYQKGVELIDAARQQLSASGISEENMAHIIYALCALLD
ETVLRRPERDHGYETWSKTPLQTRFCNSNHAGERLFERIRHVLDQPQPSLLVLAGFQRVLALGFQGGDLE
KISQERQSLLDVLTDRAGVMAVQPHQMIRVNADRHQGQYWRARSPWFWGCLAVAGITLVWCGLRLYLQQY
LSVR
 
Nucleotide Sequence: 645 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4946245-4945601 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGAACAAAGAGATTTCAATTGATGACCTGATGCTCGACATTGGGATGCTAGTGATTGCGCTAAAAAGCG
GTGATAAATCGATGTACGGTGAGGCGTTATATCAAAAAGGGGTTGAATTGATAGATGCGGCACGGCAGCA
ATTAAGTGCAAGTGGCATCAGCGAAGAGAACATGGCTCACATCATCTATGCCTTGTGTGCATTGCTGGAT
GAAACCGTACTCAGACGCCCTGAGCGGGATCATGGCTATGAAACTTGGTCGAAAACGCCGTTGCAGACAC
GATTTTGCAATAGCAACCATGCAGGAGAACGGCTGTTTGAACGTATACGTCACGTGCTGGATCAACCACA
ACCCTCTCTGCTGGTATTAGCGGGTTTCCAGCGCGTATTGGCATTGGGCTTTCAGGGCGGTGACTTGGAA
AAGATTTCTCAGGAACGCCAGTCATTACTGGATGTCCTGACTGATCGTGCCGGGGTAATGGCGGTGCAGC
CCCATCAGATGATACGCGTCAATGCAGACCGTCATCAGGGCCAATATTGGCGTGCACGCTCTCCGTGGTT
TTGGGGATGCTTGGCGGTAGCCGGAATAACTTTGGTGTGGTGCGGTCTGCGTCTCTACCTTCAGCAATAT
TTGTCTGTTAGGTAA