SecReT6
Protein ID: 37528062
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4226
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4946288..4947649 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ7MZQ1
KEGG IDplu:plu4226
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.80E-141, Aligned region: 19..450
Protein Sequence: 453 a.a.     [Download]
>gi|37528062|ref|NP_931407.1| hypothetical protein plu4226 [Photorhabdus luminescens subsp. laumondii TTO1]
MMKILRPLWIEDAFLAPQQFQQQARWEALTNNCIAHLGLIHPWGVLDIRFDQEALRLNRLKVQHLKARLP
DGTLIDTDHADNLPAVCDLQQVASADMRAVEVLLALPLEHANGGNCRQSSESVGPGQPPLRYQQEWVEIQ
DRYGNGRESIAVERHAISLRFQHDQNEAYLTCPLARLVRDGQSGWMLDDRFVPPLLSFAAHPPLLEQLDL
LLTQLRAKRTRLMGMRRESHQRMADFAVADVSLFWLLNALNSYEPVLNNFNAAPALHPEIIYRELVKLAG
ALLTFSLESDLDAIPDYQHDQLSDVFPPLIRLISTLLEASLPSRVISIELEVVRENQWRASLHDRRLCEE
ADFYLSVRSSMPAHLLQTQFPQLCKVGAPDDVERLINLSLSGIPLHPLSHVPAAIPLRLENQYFAFDLNN
PVAKAMLEAGSCAFYVPGTLSGVQLELFAVLRS
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4947649-4946288 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGATGAAAATTCTACGTCCTCTCTGGATTGAAGACGCCTTTTTAGCCCCTCAACAATTTCAGCAACAAG
CGCGTTGGGAGGCATTGACCAACAACTGTATTGCGCATCTGGGGCTGATTCACCCCTGGGGAGTGCTTGA
TATTCGGTTTGATCAGGAGGCACTGCGCTTAAACCGCCTGAAAGTTCAGCACCTCAAAGCCCGTTTACCG
GATGGGACGCTGATTGATACTGATCATGCTGACAATCTGCCTGCGGTCTGCGATTTACAGCAGGTGGCGT
CGGCGGATATGCGTGCTGTTGAGGTATTACTGGCGCTACCGCTGGAGCACGCCAATGGTGGCAATTGCCG
TCAGAGTAGTGAAAGTGTGGGGCCGGGACAACCGCCGCTACGTTATCAGCAGGAATGGGTCGAAATTCAG
GATAGATATGGCAATGGACGTGAATCCATTGCGGTTGAACGCCATGCCATTTCCCTACGCTTTCAACATG
ATCAGAATGAGGCTTATCTGACATGTCCATTGGCGCGTCTGGTGCGTGACGGACAAAGCGGTTGGATGCT
GGATGACCGTTTTGTTCCGCCATTGCTCTCTTTTGCTGCCCATCCGCCACTGCTAGAGCAGCTTGATCTG
TTGCTGACTCAGCTACGTGCTAAGCGTACCCGCCTGATGGGAATGCGCCGTGAAAGTCATCAACGCATGG
CAGACTTTGCTGTTGCGGATGTATCGCTGTTCTGGTTGTTGAATGCGCTTAACAGTTATGAACCGGTGTT
GAATAATTTTAACGCTGCCCCTGCACTGCACCCGGAAATTATCTACCGTGAACTGGTGAAGTTAGCGGGG
GCGTTACTAACGTTCTCTCTGGAGAGCGATCTCGATGCGATCCCTGATTATCAACACGACCAGTTAAGTG
ACGTTTTCCCGCCACTGATCCGGCTTATTAGTACATTACTTGAGGCGAGTCTGCCATCAAGAGTCATTTC
GATTGAACTGGAAGTGGTGCGTGAAAATCAGTGGAGAGCATCACTTCATGATAGACGATTGTGCGAAGAG
GCCGATTTCTATCTCTCAGTGCGATCGTCGATGCCAGCGCACCTGCTACAAACCCAGTTTCCGCAACTGT
GCAAAGTCGGGGCACCTGATGATGTTGAGCGGCTGATTAACTTGTCACTGAGCGGCATTCCTTTACATCC
GCTTAGCCATGTACCGGCGGCGATCCCGTTGCGGTTGGAAAACCAATATTTTGCTTTTGATCTAAATAAT
CCAGTCGCTAAAGCCATGTTGGAGGCGGGAAGTTGCGCCTTCTATGTGCCCGGTACCTTGTCGGGCGTTC
AGTTAGAACTGTTTGCGGTGTTACGTTCGTAA