SecReT6
Protein ID: 37528063
SecReT6 ID53
T6SS typeN/A
Gene symbol-
Locus tagplu4227
StrainPhotorhabdus luminescens subsp. laumondii TTO1
Repliconchromosome [GenBank: NC_005126] [Browse all T6SS(s) in this replicon]
Location [Strand]4947666..4949198 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ7MZQ0
KEGG IDplu:plu4227
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.80E-171, Aligned region: 88..506
Protein Sequence: 510 a.a.     [Download]
>gi|37528063|ref|NP_931408.1| hypothetical protein plu4227 [Photorhabdus luminescens subsp. laumondii TTO1]
MTIQEQATSSVATANHHTGGVYSSLFEKINLRPVERLSDIACFHDSDGLAGVTEDERVTAAVSVLLDLLK
ASAQKVEQLDKALLDFEIGKLDRKIGRQLDVVIHQPGFQQIESAWRGLKFLVDRTDLGQNVKIEVLDVAK
DDLRQDFDDAPEIVQSGFYRHAYIQEYDIPGSEPIGAVIADYEFSAGSQDIALLRNVAKVAAAAHMPFIT
AVAPTFFGKKSMDEVVVMKDMGHYFERAEYTQWRSFRDSEDARYIGLTLPRVLGRLPYGPKSVPVRTFNY
VEEARGPDSSKYLWTNAAFAFAANMVRSFVKNGWCVQIRGPQAGGAITDLPIHLYDLSTGYRAKIPSEVL
IPETREFEFANLGFIPLSYYKNRDYACFFSAHSTQKPAVYDTGEATANSRINARLPYIFLLSRIAHYLKL
IQRENIGTTKDRRLLEIELNNWLNTLVTEMNDPTDDMQASHPLREAYVVVEDIDDNPGFFRIKLYAVPHF
QVEGIDVNLSLVSQMPKAKS
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|37524032|ref|NC_005126.1|:c4949198-4947666 Photorhabdus luminescens subsp. laumondii TTO1, complete genome
ATGACTATACAAGAGCAGGCTACATCTTCTGTGGCGACGGCTAACCATCATACCGGTGGGGTTTACTCGT
CTTTGTTTGAGAAAATTAATTTACGTCCGGTAGAACGATTAAGTGATATTGCATGTTTTCATGACAGTGA
TGGATTGGCTGGGGTGACGGAAGATGAACGGGTGACCGCGGCGGTTAGCGTTCTTCTCGATCTGCTGAAA
GCCTCCGCGCAAAAAGTGGAACAGTTGGATAAAGCATTGCTGGATTTTGAGATCGGCAAATTGGATCGCA
AAATCGGCCGCCAACTGGATGTGGTGATACATCAGCCGGGATTTCAGCAAATAGAATCTGCCTGGCGAGG
TTTAAAATTTTTGGTTGATCGGACAGATCTCGGTCAGAACGTCAAAATTGAAGTGTTGGATGTGGCCAAG
GATGATTTGCGGCAAGATTTTGACGATGCACCGGAAATTGTTCAGAGCGGTTTCTATCGTCACGCTTACA
TTCAGGAATATGACATACCGGGTAGCGAACCGATTGGCGCAGTGATTGCCGACTATGAATTTAGTGCCGG
ATCGCAGGATATTGCCTTATTGCGCAACGTAGCCAAAGTTGCGGCAGCGGCGCACATGCCATTTATTACT
GCTGTCGCTCCAACTTTTTTTGGCAAAAAGAGCATGGATGAAGTGGTGGTGATGAAAGATATGGGTCACT
ATTTTGAACGCGCCGAATACACCCAGTGGAGATCTTTCCGCGACAGTGAAGATGCCCGTTATATTGGCCT
CACCTTGCCAAGAGTGTTGGGACGTCTGCCATATGGCCCGAAGAGTGTGCCGGTGCGAACGTTTAATTAT
GTCGAAGAAGCAAGAGGGCCGGATAGCAGTAAATATTTGTGGACCAATGCCGCTTTTGCTTTTGCCGCCA
ATATGGTCAGGAGTTTTGTCAAAAATGGCTGGTGTGTGCAGATCCGTGGTCCGCAAGCCGGTGGTGCTAT
CACTGATTTGCCGATCCACCTCTACGATCTGAGTACCGGTTATCGGGCTAAGATCCCATCAGAAGTGCTG
ATCCCGGAAACCCGTGAATTTGAATTTGCCAATTTGGGTTTTATTCCGCTCTCTTACTATAAAAATCGCG
ATTATGCCTGCTTCTTTTCGGCTCACTCCACGCAGAAGCCCGCAGTGTATGACACCGGTGAAGCCACGGC
CAACAGTCGCATCAATGCGCGTCTGCCCTACATCTTCCTGTTATCGCGCATTGCTCATTACTTAAAGCTG
ATCCAGCGGGAGAACATTGGCACCACTAAAGATCGGCGTCTGCTTGAAATTGAACTGAATAACTGGCTCA
ACACACTGGTAACGGAGATGAATGATCCGACTGACGACATGCAGGCATCTCATCCGCTGCGTGAAGCATA
TGTGGTAGTTGAGGATATTGATGACAATCCGGGATTCTTCCGAATCAAACTGTATGCGGTGCCGCATTTT
CAGGTGGAAGGGATTGACGTCAATTTATCTCTGGTTTCTCAGATGCCGAAAGCGAAATCGTAA