SecReT6
Protein ID: 375358266
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1972
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2330059..2330952 [-]
Producthypothetical protein
NoteTssP
UniProt IDE1WVH1
KEGG IDbfg:BF638R_1972
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 7.80E-13, Aligned region: 42..98
PKD [PF00801], Evalue: 7.80E-13, Aligned region: 143..179
Protein Sequence: 297 a.a.     [Download]
>gi|375358266|ref|YP_005111038.1| hypothetical protein BF638R_1972 [Bacteroides fragilis 638R]
MMNKFLNTKVLYIFISVIILIMVFLLVMRACSQKQPIQAVVTPSDPVVGEEIFFSDSTSGARIWYWEFGN
NETSTQRSGHHRFKQKGVYKIRLTVNGNLERYFDVRVKEKTNTEDLHLVHIIAPKEAIQGENIIFRGEGH
DEQWRWEFGETGMIDSREKTALYAYTEPGEYEVLLNTENTRYPIRHRINILPYYSENDSTDVMVLIGLDI
KEKLQNIADGKPFNVNYNYVVDKYFNNNPNTLVIINNNKYNDFYSYCQGLHHIGRKETIIQNVIVETEDE
ESGYITQITVMQIEKKK
 
Nucleotide Sequence: 894 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2330952-2330059 Bacteroides fragilis 638R, complete genome
ATGATGAATAAATTCCTAAATACGAAGGTTCTCTATATCTTTATCTCCGTTATCATACTTATTATGGTTT
TTCTGTTGGTAATGAGAGCTTGCTCGCAGAAGCAGCCGATTCAGGCTGTTGTAACTCCGTCTGACCCTGT
CGTGGGGGAAGAAATATTTTTTTCCGATTCCACGTCGGGAGCGAGAATCTGGTACTGGGAGTTCGGAAAC
AACGAGACATCCACACAACGCAGCGGACACCATCGGTTCAAGCAAAAAGGGGTGTACAAAATACGACTGA
CCGTCAACGGAAATCTGGAACGCTACTTTGATGTGAGGGTAAAAGAGAAGACCAATACGGAAGACCTGCA
TCTGGTTCATATCATAGCTCCCAAGGAAGCCATTCAGGGAGAAAATATCATCTTCCGTGGCGAAGGACAC
GACGAACAATGGCGCTGGGAGTTCGGAGAGACGGGGATGATTGATTCTCGTGAAAAAACGGCTCTTTATG
CTTATACCGAACCCGGAGAGTACGAAGTATTGCTTAATACGGAGAATACCCGGTATCCCATCAGACACCG
GATAAACATTCTGCCCTACTATTCGGAGAATGATTCTACCGATGTAATGGTGCTCATCGGTTTAGACATC
AAAGAGAAGTTACAGAACATTGCAGACGGTAAACCCTTTAATGTAAACTACAACTATGTCGTGGACAAGT
ATTTTAATAATAACCCGAACACGCTGGTTATTATCAACAACAATAAATATAACGACTTTTATTCTTATTG
CCAAGGACTGCACCATATCGGCAGAAAAGAAACGATTATCCAGAATGTCATCGTAGAGACGGAGGATGAA
GAGAGCGGATATATTACCCAAATAACGGTTATGCAAATCGAAAAAAAGAAATGA