SecReT6
Protein ID: 375358267
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1973
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2330949..2331476 [-]
Producthypothetical protein
NoteTssO
UniProt IDE1WVH2
KEGG IDbfg:BF638R_1973
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 175 a.a.     [Download]
>gi|375358267|ref|YP_005111039.1| hypothetical protein BF638R_1973 [Bacteroides fragilis 638R]
MSITPKNKSSKAVSERERFIGFVYVLTLFIVITGACGFILFKYAGTRHIFSNKIMVIKKMERQKEFQNIQ
SVQIVSADTLFSRIEQFEPGVNASYEENDIKFLINDLAKQWEKNSFDKRNKMFWHLASVYEMWFADKKEL
WSKQDNIVKFRKNLEECEVGLQKKEGELKNKGGKP
 
Nucleotide Sequence: 528 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2331476-2330949 Bacteroides fragilis 638R, complete genome
ATGAGCATAACCCCTAAAAATAAAAGCAGCAAAGCCGTTAGCGAGCGTGAACGCTTTATCGGATTTGTAT
ATGTGCTTACCCTGTTTATTGTTATCACAGGAGCCTGTGGATTTATTCTTTTCAAGTATGCAGGGACACG
CCACATCTTCTCCAATAAAATAATGGTCATTAAAAAGATGGAGCGGCAAAAGGAATTTCAAAACATACAA
TCTGTACAGATTGTGAGCGCAGATACCCTATTTTCACGTATTGAACAGTTTGAGCCGGGCGTCAATGCCT
CTTATGAGGAAAATGATATCAAGTTCCTGATAAACGACCTTGCCAAACAATGGGAGAAAAACAGCTTTGA
CAAGCGCAATAAGATGTTCTGGCATCTCGCTTCGGTATATGAAATGTGGTTTGCCGATAAGAAAGAACTA
TGGAGCAAGCAGGATAACATAGTGAAGTTCAGGAAAAATCTGGAGGAGTGCGAAGTCGGACTCCAGAAGA
AAGAAGGCGAACTTAAAAATAAAGGAGGCAAGCCATGA