SecReT6
Protein ID: 375358268
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1974
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2331489..2331992 [-]
Producthypothetical protein
NoteTssO
UniProt IDE1WVT1
KEGG IDbfg:BF638R_1974
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 167 a.a.     [Download]
>gi|375358268|ref|YP_005111040.1| hypothetical protein BF638R_1974 [Bacteroides fragilis 638R]
MKAKNSEKIIRGYLEFAGGLLISTALSMALLTGFIHTNGSEYKLMESKTQEYDKIYARQIALVDKVDSLY
NYLVLMGSNDRLNQVVLQKVISTRKMELIEELQIMDSKDVLLYKKLASQINVFLDTKEAIRKAVIEESLV
RKDLMRCIQDNKQATRKLTLGNISVEK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2331992-2331489 Bacteroides fragilis 638R, complete genome
ATGAAAGCAAAGAACAGTGAGAAAATCATCCGTGGATATTTGGAGTTTGCCGGCGGACTGTTAATCAGTA
CGGCTTTGAGCATGGCACTACTCACAGGCTTTATCCATACGAATGGAAGCGAATATAAACTGATGGAATC
CAAAACGCAAGAATACGATAAGATTTACGCCAGACAGATTGCCCTGGTGGATAAGGTGGATTCGCTGTAT
AACTACCTGGTGCTGATGGGCAGTAACGACCGGCTTAATCAGGTGGTGCTCCAAAAAGTTATCAGTACAC
GCAAGATGGAACTTATCGAGGAACTGCAAATAATGGATAGTAAGGATGTACTTCTGTACAAAAAACTGGC
TTCGCAAATCAACGTGTTTCTGGATACCAAAGAAGCCATACGTAAAGCGGTTATTGAAGAAAGCCTTGTG
AGAAAAGACCTGATGCGGTGCATTCAGGACAATAAACAGGCTACCCGAAAGCTGACATTGGGAAACATTA
GTGTAGAAAAGTAA