SecReT6
Protein ID: 375358269
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1975
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2331998..2332954 [-]
Producthypothetical protein
NoteTssG
UniProt IDE1WVT2
KEGG IDbfg:BF638R_1975
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.80E-11, Aligned region: 177..316
Protein Sequence: 318 a.a.     [Download]
>gi|375358269|ref|YP_005111041.1| hypothetical protein BF638R_1975 [Bacteroides fragilis 638R]
MEHRLPKEIKGLLPPNTMDTDFKAELYGALLAEAGFDTAQIMMVRDGNNLSNVSKDIRSVKHRNHVGIAE
GAYIELKTNRRGIYDSLPEGLFHEALFPGKVKDLELILEEMQQHRNEEFFIRRFFSLLESEVDREGIQAQ
LLELRYDKKNKYSDYAKLFAACWPVIHILSGQGALLFIKFMPHIHSIRGRLEEVSDALSQILEAPVKVRP
KMVQRTIRAQKPNRLGNMRLGANSVNVGVLNSAEADLHIHIGDLPTREVERFLPGNRSRKALEMLADIFL
GAWQEFDVTVSVSPDERKTYLKPTGDASPCYLGINTYL
 
Nucleotide Sequence: 957 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2332954-2331998 Bacteroides fragilis 638R, complete genome
ATGGAACATCGCTTACCCAAAGAGATAAAGGGGCTTCTTCCGCCCAATACAATGGACACCGACTTCAAGG
CAGAGCTATACGGAGCCTTGCTAGCGGAAGCCGGGTTCGACACCGCTCAAATTATGATGGTGCGTGACGG
TAATAACCTGAGCAATGTTTCGAAAGATATCCGATCGGTGAAGCATAGGAATCATGTCGGCATAGCGGAG
GGGGCATACATAGAACTAAAGACCAACCGCCGGGGGATTTATGATTCGCTGCCGGAGGGATTGTTCCATG
AGGCGCTTTTTCCCGGCAAGGTGAAAGATTTGGAACTGATTTTGGAGGAGATGCAGCAGCATCGCAACGA
AGAGTTCTTTATCCGCCGCTTTTTCAGCCTGCTGGAGAGTGAAGTGGACAGAGAAGGGATACAGGCACAA
TTGCTCGAATTGCGGTATGATAAAAAGAACAAATATTCTGATTATGCGAAACTCTTTGCCGCTTGCTGGC
CGGTCATTCATATTTTGTCCGGACAGGGGGCGTTGCTGTTCATCAAGTTCATGCCGCATATCCATTCGAT
CCGGGGCAGACTGGAAGAGGTAAGCGACGCACTGTCGCAGATTCTGGAAGCTCCGGTCAAGGTACGCCCC
AAAATGGTGCAACGGACAATAAGGGCACAAAAACCGAACCGGCTGGGGAACATGAGACTGGGAGCAAACA
GTGTGAATGTGGGGGTGCTTAATAGTGCTGAGGCTGATTTGCATATACACATAGGCGACCTGCCAACTCG
GGAAGTCGAAAGGTTCCTGCCCGGCAACCGCTCCCGCAAAGCCCTTGAAATGCTGGCGGATATTTTTCTT
GGCGCGTGGCAGGAGTTCGATGTGACGGTCAGCGTTAGCCCTGACGAACGCAAGACTTATTTAAAACCGA
CGGGTGACGCCAGTCCGTGTTACCTCGGGATAAACACTTATTTATAA