SecReT6
Protein ID: 375358270
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1976
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2332956..2334098 [-]
Producthypothetical protein
NoteTssK
UniProt IDE1WVT3
KEGG IDbfg:BF638R_1976
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.00017, Aligned region: 164..210
Protein Sequence: 380 a.a.     [Download]
>gi|375358270|ref|YP_005111042.1| hypothetical protein BF638R_1976 [Bacteroides fragilis 638R]
MAKKNLVNWSDCMPLSAAIFSQHDDYFLDSIRDSIEVRTNSYNYGLLPARQNRDGENGIRISQHVTGHIE
VRLKSCEAITSSGIRIQFDATETGSELVKNYSVESDTRKNITQWDIILSVDPFHRVGSGDPNPEEVPPRH
PNALPSYRLFVMPKGEINVSELGAHYLTIGRIRKDAERFMVDADFIPPCTTMKSHPELQEYHAKFGNMFR
SLENYSKIIIAKIHNRDNRGELGAHISLICREMLRYLATLQFSYTNKGLYNAPIDVLEAVSSLAHIMYVS
FSYLSGTQKEETQKYFYEWSDVTPGSFDEQLADTLEMLYEHTDIRASMVRAYSFMYTLTELWQRLSTLEY
IGQHKENIVVSERTTGNNTTGQNKTWSIMD
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2334098-2332956 Bacteroides fragilis 638R, complete genome
ATGGCAAAGAAAAATTTAGTAAACTGGTCGGACTGTATGCCGCTGTCAGCCGCCATCTTCAGCCAACATG
ACGATTACTTTCTGGACAGCATTCGCGACAGCATAGAAGTACGAACCAACAGTTATAACTACGGGTTGCT
GCCCGCCCGACAAAACCGGGATGGGGAGAACGGTATCCGTATCAGCCAGCACGTGACCGGACACATTGAA
GTGCGGCTGAAATCCTGTGAAGCAATCACCTCTTCGGGCATCCGCATCCAATTTGATGCCACCGAAACGG
GAAGCGAATTAGTGAAGAACTATTCTGTAGAATCGGATACCCGTAAGAATATCACGCAATGGGACATTAT
CCTCTCCGTGGATCCGTTCCACCGGGTAGGCTCGGGTGACCCCAATCCGGAGGAAGTTCCACCCCGCCAT
CCGAACGCCTTGCCCTCCTATCGGCTGTTTGTGATGCCCAAAGGAGAAATCAATGTGAGTGAGCTGGGGG
CGCATTACCTGACCATCGGCCGTATCCGCAAGGATGCCGAACGATTCATGGTAGATGCCGACTTTATCCC
GCCCTGTACGACAATGAAAAGCCACCCCGAACTGCAAGAGTATCATGCCAAGTTCGGAAATATGTTCCGC
TCACTGGAGAATTACAGCAAAATCATCATAGCTAAAATACATAACAGGGATAATCGCGGCGAACTGGGTG
CGCACATCTCTCTGATATGCCGTGAGATGCTCCGCTATCTCGCCACCCTGCAATTCAGTTATACCAATAA
AGGGTTATACAATGCTCCCATAGACGTATTGGAAGCCGTATCGAGTCTGGCGCATATCATGTATGTAAGT
TTCAGCTACCTATCAGGGACGCAAAAGGAGGAAACGCAGAAATATTTCTACGAGTGGAGCGACGTAACGC
CCGGTTCGTTCGACGAGCAACTCGCCGATACGTTGGAGATGCTGTACGAACATACGGATATCCGGGCTTC
GATGGTTCGTGCCTATTCGTTTATGTACACACTTACCGAATTGTGGCAACGGCTCAGTACGCTGGAATAT
ATCGGTCAGCATAAGGAGAATATTGTAGTATCGGAACGCACTACGGGGAACAATACTACGGGACAGAACA
AAACATGGAGCATAATGGATTGA