SecReT6
Protein ID: 375358271
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1977
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2334126..2334974 [-]
Productputative transmembrane protein
NoteTssN
UniProt IDE1WVT4
KEGG IDbfg:BF638R_1977
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 282 a.a.     [Download]
>gi|375358271|ref|YP_005111043.1| putative transmembrane protein [Bacteroides fragilis 638R]
MDSFFQTLAFTYLLYPILGLLLVGLGIFIAKKNALLNNKRLVGYTIGAIAILTLPALLGFLDYGFMPYGY
IFLAMLYLLLGSYNIRMIAWVFKDDYKYRHEIILTSFILVVSMLFFTLVFNLCNELKYGLWASTCLLPFV
IVSVFIRTYRIFIAIPIPVYEVWRYTDDTEQEGYFDPGSLQVLQIELYKQESDREPVKLSVKAPDEMQFG
TWFHRMIDDYNLKSPQAPIDDYAAKEGGWIFYRKPTLLSPRHYIDFNLTVKDNRIRSRDVIVAKRVMEHN
EN
 
Nucleotide Sequence: 849 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2334974-2334126 Bacteroides fragilis 638R, complete genome
ATGGACTCATTTTTCCAGACCCTCGCCTTCACATATCTGCTCTACCCGATATTGGGATTGTTACTGGTAG
GCTTAGGCATTTTCATAGCCAAGAAAAACGCTCTGCTGAACAACAAGCGGCTGGTAGGCTACACTATCGG
TGCAATTGCCATCCTGACGCTCCCTGCTTTGTTGGGATTCCTTGATTACGGTTTCATGCCCTACGGCTAC
ATCTTCCTTGCCATGCTGTATCTCCTTCTGGGCAGTTATAACATACGAATGATTGCGTGGGTTTTTAAGG
ACGACTACAAGTACCGCCACGAAATCATACTCACCAGTTTTATACTGGTGGTATCCATGTTGTTCTTCAC
CCTTGTCTTCAATCTCTGCAATGAATTGAAATACGGTCTGTGGGCATCCACCTGCCTGCTTCCATTCGTC
ATTGTCTCGGTATTTATCCGCACCTACCGTATCTTTATCGCCATTCCGATTCCCGTGTATGAAGTATGGA
GATACACAGACGATACCGAGCAGGAGGGATATTTTGACCCGGGCAGCCTGCAAGTTCTGCAAATAGAGCT
ATACAAGCAAGAAAGCGACCGGGAACCGGTCAAACTCAGTGTGAAAGCACCGGACGAAATGCAATTTGGC
ACATGGTTCCACCGGATGATTGACGACTATAATCTGAAATCTCCGCAAGCCCCGATAGACGACTATGCAG
CAAAAGAGGGAGGATGGATTTTCTACCGGAAACCCACCTTGCTATCTCCCCGACATTACATAGACTTCAA
CCTTACCGTAAAGGATAACCGCATCCGCAGCCGTGATGTAATTGTTGCTAAACGGGTAATGGAACATAAT
GAGAACTAA