SecReT6
Protein ID: 375358274
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1980
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2339030..2339716 [-]
Producthypothetical protein
NotePAAR
UniProt IDE1WVT7
KEGG IDbfg:BF638R_1980
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 6.70E-16, Aligned region: 17..88
Protein Sequence: 228 a.a.     [Download]
>gi|375358274|ref|YP_005111046.1| hypothetical protein BF638R_1980 [Bacteroides fragilis 638R]
MKQIVTVTLNHICPMVTGITPHVGGPIIGPGCPGVLVNGTPVSLMGDACVCCGPPDMIAQGYPGIMVDGI
PVVVQNCMTAHGGTIPMGVPGVTVGNATPIEPMTMHIKRIPFPRIRVIDKIGAAISGNSKRLKQAADNQN
DLRKKAFREELAIYNVHWEREEVFTDEGFMRHKITVVADTSGYEEGETITFTITPDDIDPDFGLQPDEKQ
VEGTVENGRVRAEWLVEI
 
Nucleotide Sequence: 687 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2339716-2339030 Bacteroides fragilis 638R, complete genome
ATGAAACAGATTGTGACAGTAACTTTAAATCATATATGTCCAATGGTCACAGGGATAACACCCCATGTGG
GAGGTCCAATCATAGGTCCCGGTTGTCCGGGAGTATTGGTAAATGGAACACCGGTATCCCTTATGGGAGA
TGCCTGCGTATGTTGTGGCCCTCCTGACATGATAGCGCAAGGATATCCGGGAATAATGGTTGATGGTATC
CCTGTGGTCGTACAAAACTGTATGACAGCCCACGGAGGCACTATCCCCATGGGCGTGCCTGGAGTAACGG
TAGGCAATGCTACACCGATAGAGCCCATGACAATGCACATTAAGAGAATACCCTTTCCTCGGATTCGCGT
AATCGATAAAATAGGAGCGGCTATCTCGGGAAACTCGAAGAGACTAAAACAGGCTGCTGACAATCAAAAT
GACTTGCGCAAAAAAGCATTTCGGGAGGAACTGGCTATATACAATGTGCATTGGGAAAGAGAAGAGGTAT
TTACCGACGAAGGATTTATGCGGCATAAAATAACCGTTGTGGCCGACACGTCTGGATATGAAGAGGGTGA
AACCATTACTTTTACCATTACCCCCGACGATATAGACCCTGACTTCGGGCTACAACCCGATGAAAAGCAA
GTGGAAGGAACGGTGGAAAATGGTCGTGTCCGTGCGGAATGGTTAGTTGAAATTTGA