SecReT6
Protein ID: 375358275
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1981
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2339735..2341585 [-]
Producthypothetical protein
NoteVgrG
UniProt IDE1WVT8
KEGG IDbfg:BF638R_1981
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 6.10E-14, Aligned region: 378..454
Phage_GPD [PF05954], Evalue: 6.30E-10, Aligned region: 61..192
DUF2345 [PF10106], Evalue: 4.00E-05, Aligned region: 503..595
DUF3540 [PF12059], Evalue: 0.00014, Aligned region: 6..34
DUF3540 [PF12059], Evalue: 0.00014, Aligned region: 399..434
DUF3540 [PF12059], Evalue: 0.00014, Aligned region: 499..533
DUF3540 [PF12059], Evalue: 0.00014, Aligned region: 541..602
Sarcoglycan_1 [PF04790], Evalue: 0.0005, Aligned region: 502..556
Protein Sequence: 616 a.a.     [Download]
>gi|375358275|ref|YP_005111047.1| hypothetical protein BF638R_1981 [Bacteroides fragilis 638R]
MASTNLDAVSVEIKVAGKVCDYVTMELFQSVSTHHRFKIKVNYRPDKPSVWAIGPDVIFKQLGEKVSIIM
THHESGEKTEFHGLISDIHVEGFDGNQGFVILEGGSPTILLDRDPAMDCYVEQNLNTIVSDILDKSGVKM
NVTNNPKHTDIIPYVARYKETSYGFLSRLLRSYGEWFYYNGETLQIGDPEIDTESRAGYDVDLTSVNINA
TIRSLNHSTYEFDPVNDKFYYDYSGTPKGATLGSRSAEKCSEPIFPTEARLPSIRPAYSAMDLEHYGDAG
FHRNYSQLSQMRATSRYCGIRLGELVVTRVPESFPGVKIPDLGRYRITEITHTVNSKGQYSNTFCGVPGG
TPVMPWGDAVMPVAYPEMARVLSNDDPKNQGRVKVRFMWQEIDGGESYWMRVQSPDAGKSEQVAKNRGFV
FIPEPGDLVMVGFEQGNPDRPYVTGSLFYKANSEGAGTDNSVKSIRTRSGHTLEFNDDEGGNWGITIKDG
NGCILHLDTKGKNIEITAPETLSLTAKNVSINAEENVQIAAKQNIDVTAEADINIAAKGNLMQQTDGDLS
VSAKGSINAEAKTDVSLSGQNTTVDGKTKVTVSGAETLVSGKMTTVQGAAHKIDVM
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2341585-2339735 Bacteroides fragilis 638R, complete genome
ATGGCATCGACAAACTTGGACGCTGTAAGCGTGGAGATAAAAGTAGCAGGAAAAGTCTGCGATTATGTAA
CAATGGAACTTTTTCAGTCGGTCAGTACACACCACCGTTTCAAAATCAAAGTAAACTATCGTCCGGACAA
GCCAAGTGTCTGGGCTATCGGTCCCGATGTGATATTCAAGCAACTGGGTGAGAAGGTATCCATCATCATG
ACCCACCATGAGAGTGGGGAGAAAACGGAATTTCACGGACTGATTTCTGATATTCATGTGGAAGGCTTCG
ACGGTAATCAGGGATTTGTCATTCTGGAAGGGGGAAGCCCTACCATCCTGCTTGACAGAGACCCTGCTAT
GGACTGCTATGTAGAACAAAACCTGAATACGATAGTCAGCGACATACTTGACAAGAGCGGGGTGAAAATG
AATGTGACCAACAATCCCAAACATACGGACATCATCCCCTATGTCGCCCGCTATAAAGAGACAAGCTACG
GGTTTCTTTCCCGTCTGCTCCGCTCCTACGGCGAATGGTTCTATTACAACGGGGAAACATTGCAGATAGG
AGACCCGGAAATAGATACGGAAAGCCGTGCAGGGTATGATGTAGACCTGACGAGTGTCAACATCAATGCC
ACCATCCGTTCGCTGAACCACAGCACCTATGAGTTCGACCCAGTCAACGACAAGTTCTATTACGACTACA
GCGGAACGCCTAAAGGCGCCACCCTTGGTTCCCGTTCGGCTGAGAAATGCAGTGAACCTATCTTCCCTAC
CGAAGCGAGACTCCCCTCGATAAGACCCGCATATAGCGCAATGGATTTGGAGCACTACGGAGATGCCGGA
TTTCACCGCAACTATTCCCAATTGTCTCAAATGAGGGCTACGAGCCGTTATTGCGGCATCCGGCTGGGAG
AATTGGTGGTTACCCGTGTACCCGAAAGTTTCCCGGGAGTTAAGATTCCCGATTTGGGACGTTACCGCAT
CACGGAGATTACCCATACGGTAAACAGTAAAGGACAATATAGCAACACCTTCTGCGGTGTACCGGGTGGT
ACGCCCGTCATGCCGTGGGGAGACGCCGTGATGCCGGTAGCCTATCCGGAGATGGCAAGAGTGTTGAGCA
ATGACGACCCCAAGAATCAGGGGCGTGTCAAGGTGCGGTTCATGTGGCAGGAGATAGACGGCGGCGAGAG
CTACTGGATGCGGGTGCAAAGCCCGGATGCAGGCAAGAGCGAGCAAGTAGCCAAGAACCGTGGTTTTGTG
TTTATTCCCGAACCGGGTGATTTGGTGATGGTAGGTTTTGAGCAAGGCAATCCAGACCGTCCGTATGTGA
CAGGAAGCCTTTTCTATAAGGCTAATTCAGAGGGAGCGGGAACGGACAACAGTGTAAAGAGTATCCGTAC
ACGCAGCGGACATACGTTAGAGTTCAATGATGATGAGGGTGGTAACTGGGGCATTACGATTAAGGATGGT
AACGGTTGTATACTCCATTTAGACACTAAAGGAAAAAATATTGAAATCACTGCCCCGGAAACCCTGTCTT
TGACAGCAAAGAACGTTAGCATCAATGCTGAAGAAAATGTTCAGATTGCAGCTAAACAGAATATAGATGT
AACCGCCGAAGCCGATATAAATATTGCGGCCAAAGGCAATTTGATGCAGCAGACAGACGGTGACCTGTCA
GTTTCCGCAAAAGGAAGCATAAATGCCGAAGCGAAAACCGATGTCAGTCTCTCGGGTCAAAATACAACGG
TAGACGGTAAGACCAAAGTGACAGTAAGCGGTGCAGAAACATTAGTATCAGGCAAGATGACAACTGTGCA
GGGAGCTGCCCACAAAATAGATGTAATGTAA