SecReT6
Protein ID: 375358276
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1982
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2341611..2343428 [-]
Producthypothetical protein
NoteTssF
UniProt IDE1WVT9
KEGG IDbfg:BF638R_1982
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 605 a.a.     [Download]
>gi|375358276|ref|YP_005111048.1| hypothetical protein BF638R_1982 [Bacteroides fragilis 638R]
MANLFTKESIKARMFKQAATLYDIRNIDGIDPLIRLLIEALSGEIFKLSGDVHAIESRLLEKVASALTPH
TALVARPAHAIAAARSYSPQAIVSPTDLFAYKSTEIVKKYKMKNLFFTPLHETRIINAELKYLVTADEFC
TISPEGERDAIAHLHSGVPVMGRKISIGMKIGSNVTTLNDLPLYIDIPHVADKSSYLKLLPYCHCTIAGI
PIEIKGGIEYDSARSVSEKYDLGRLITEEITSKYAPHYLTLKAPGLKVRDLSRSRVPEEISSLLPGDFIA
GCDADTVWIDIEFPTAFSKEVLEQVKVQMNTFIVVNKYPAKITRKVDSVSAILPLEKTEFEYFLFVDSIT
DNHGDQLREISSTQDESRAGCYSVRRGGCERFNAMDAKDFLNRLTDLLYDESVAFSSTDKDGMKEVIEQI
EERVNQLGDKNKDGVGGQEMLSYVVIDQRYDKDTRLTVDYTLTNGEFANDIYAGEPLNDCANPDIDKDTL
RFVTSVHGGKPSPSVKRRMDMYRFMLLSHGSIYTKEDIRNFCMARYGDSIRSVEVKLGYAAGKKESEGFI
RTLDVYLRLSEGMQGLDKEEFVVELDSELRRLSPETYNYRVFINS
 
Nucleotide Sequence: 1818 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2343428-2341611 Bacteroides fragilis 638R, complete genome
ATGGCAAATCTATTCACAAAAGAAAGCATTAAAGCCCGGATGTTCAAACAGGCGGCAACCCTATATGACA
TACGAAATATAGATGGTATAGACCCTCTTATCCGACTGCTGATTGAAGCCTTGTCGGGTGAAATCTTCAA
GCTGTCCGGTGATGTGCACGCCATTGAAAGCCGTTTGTTGGAGAAAGTCGCTTCCGCCCTTACTCCCCAC
ACAGCATTGGTTGCCCGCCCCGCCCATGCCATTGCTGCCGCCCGGTCGTACTCCCCGCAAGCCATTGTGT
CCCCTACAGACCTGTTTGCTTATAAAAGCACGGAGATTGTGAAGAAGTATAAAATGAAAAATCTCTTCTT
TACTCCGCTGCATGAAACCCGCATAATCAATGCCGAATTGAAATATCTCGTTACGGCGGATGAATTTTGC
ACAATCAGTCCCGAAGGAGAGCGTGACGCCATTGCGCACCTTCACTCCGGCGTACCGGTGATGGGGCGGA
AAATCAGCATCGGGATGAAGATTGGCAGCAATGTAACTACTCTCAACGACTTGCCATTATACATAGATAT
ACCACATGTAGCGGATAAGAGCAGCTATCTGAAATTACTGCCGTACTGCCATTGCACGATTGCCGGTATC
CCTATAGAAATTAAAGGAGGAATCGAGTACGACTCCGCACGTTCGGTCAGTGAGAAATACGACCTTGGCA
GGCTGATTACGGAAGAAATAACCAGCAAATATGCTCCCCACTACCTGACATTGAAAGCTCCCGGATTAAA
AGTCAGAGATTTGTCACGTAGCAGAGTGCCCGAAGAAATCTCTTCCCTGCTGCCAGGTGATTTCATTGCC
GGATGTGATGCGGACACCGTGTGGATAGATATAGAATTTCCCACCGCTTTTTCAAAAGAAGTACTGGAAC
AGGTAAAGGTGCAGATGAACACTTTCATCGTAGTAAACAAATATCCGGCAAAGATTACCAGAAAGGTGGA
TTCCGTCTCTGCCATTCTCCCTTTGGAAAAGACGGAATTTGAATATTTCCTGTTTGTGGATTCGATTACC
GATAACCACGGAGACCAACTTAGGGAAATTTCCAGCACACAGGATGAAAGTAGAGCCGGCTGTTATTCGG
TCAGAAGGGGCGGTTGCGAACGCTTCAATGCGATGGACGCCAAAGATTTTCTGAACCGTCTGACAGACCT
GCTATATGACGAAAGCGTGGCTTTCTCTTCGACAGACAAAGACGGGATGAAAGAGGTGATCGAGCAGATA
GAGGAACGGGTAAACCAATTGGGAGATAAGAATAAAGACGGAGTCGGAGGACAGGAAATGCTGTCGTATG
TAGTCATAGACCAACGTTATGACAAGGATACCCGGTTAACTGTGGATTATACTCTTACTAATGGCGAATT
TGCCAATGACATCTATGCGGGAGAACCGTTGAATGACTGCGCAAATCCCGATATAGACAAAGATACGCTG
CGGTTTGTCACTTCCGTTCATGGAGGAAAGCCTTCCCCATCCGTAAAGCGCCGGATGGATATGTACCGAT
TCATGCTGTTGTCACACGGCAGCATATACACAAAAGAGGATATACGCAATTTCTGCATGGCAAGGTATGG
CGACAGCATCCGCTCTGTGGAGGTAAAGCTCGGGTATGCAGCCGGTAAAAAAGAAAGCGAAGGTTTCATA
AGGACGCTGGACGTGTATCTACGGTTATCGGAGGGGATGCAAGGATTAGACAAGGAAGAGTTCGTTGTCG
AATTGGACAGTGAGCTCAGGCGGTTGTCTCCGGAGACCTATAACTACCGTGTTTTTATTAACTCATAG