SecReT6
Protein ID: 375358277
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1983
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2343459..2343899 [-]
Productputative bacteriophage Gp25 protein
NoteTssE
UniProt IDE1WVU0
KEGG IDbfg:BF638R_1983
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.30E-18, Aligned region: 24..128
Protein Sequence: 146 a.a.     [Download]
>gi|375358277|ref|YP_005111049.1| putative bacteriophage Gp25 protein [Bacteroides fragilis 638R]
MKQKYYKLPVRLEKLFEGDIRQLERCSELESIDQHIELLLTTCPGEHRFDPKYGCRIWELDFERIVSTEQ
WKELFTGYVMQAISTYEKRISDITLSVNLQEIVREEVLDNRMIRKRVDITVLATLNSTGAPCGFGYKLYM
GPLSNE
 
Nucleotide Sequence: 441 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2343899-2343459 Bacteroides fragilis 638R, complete genome
ATGAAACAGAAATACTATAAACTACCGGTACGTTTGGAAAAGCTCTTCGAAGGAGATATCCGGCAACTGG
AAAGATGTTCCGAACTGGAATCCATCGACCAGCACATCGAACTGTTGCTGACCACCTGTCCGGGTGAGCA
CCGTTTCGACCCCAAATACGGTTGTCGGATTTGGGAGTTGGACTTTGAGCGCATTGTTTCTACCGAACAA
TGGAAAGAACTGTTTACCGGATACGTGATGCAGGCGATTTCCACTTATGAGAAACGCATTTCCGACATCA
CTCTCTCGGTAAACCTACAAGAAATCGTCAGGGAAGAAGTTCTGGATAACCGGATGATACGTAAGCGGGT
AGATATTACAGTACTCGCCACATTGAATTCCACCGGTGCTCCCTGCGGTTTCGGTTACAAATTATACATG
GGGCCTTTATCAAACGAATAA