SecReT6
Protein ID: 375358279
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1985
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2344359..2344778 [-]
Producthypothetical protein
NoteHcp
UniProt IDE1WVU2
KEGG IDbfg:BF638R_1985
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 139 a.a.     [Download]
>gi|375358279|ref|YP_005111051.1| hypothetical protein BF638R_1985 [Bacteroides fragilis 638R]
MGFFDRLFKGKEVFADRRNPDMVCEMTLCGESHILSEFDIAYEPDNSSKEYMEAYAVFSEPVNAEVENWI
MQSNRKENGVVRFYRNSDAMDEGALFEIKFSDASCVHYRNVSQGDASVKTIVMTFPSVRMGGDEFELKR
 
Nucleotide Sequence: 420 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2344778-2344359 Bacteroides fragilis 638R, complete genome
ATGGGCTTTTTCGACAGGCTGTTTAAAGGAAAAGAAGTGTTTGCGGACAGACGCAATCCGGATATGGTAT
GCGAAATGACGCTTTGCGGAGAGTCGCACATCTTGTCCGAGTTTGATATTGCCTATGAGCCGGATAATTC
CTCGAAAGAATATATGGAAGCATACGCTGTGTTCTCGGAGCCGGTAAATGCGGAGGTAGAGAACTGGATA
ATGCAATCGAACAGAAAAGAGAACGGAGTAGTCCGATTCTACCGCAACAGCGATGCTATGGACGAAGGTG
CACTGTTCGAGATAAAATTCAGTGATGCAAGTTGCGTGCATTATCGCAATGTATCGCAGGGAGACGCATC
GGTAAAGACCATTGTGATGACTTTTCCGTCTGTCCGGATGGGAGGTGATGAATTTGAACTAAAACGATAA