SecReT6
Protein ID: 375358279
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1985
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2344359..2344778 [-]
Producthypothetical protein
NoteHcp
UniProt IDE1WVU2
KEGG IDbfg:BF638R_1985
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 139 a.a.     [Download]
>gi|375358279|ref|YP_005111051.1| hypothetical protein BF638R_1985 [Bacteroides fragilis 638R]
MGFFDRLFKGKEVFADRRNPDMVCEMTLCGESHILSEFDIAYEPDNSSKEYMEAYAVFSEPVNAEVENWI
MQSNRKENGVVRFYRNSDAMDEGALFEIKFSDASCVHYRNVSQGDASVKTIVMTFPSVRMGGDEFELKR
 
Nucleotide Sequence: 420 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2344778-2344359 Bacteroides fragilis 638R, complete genome
ATGGGCTTTTTCGACAGGCTGTTTAAAGGAAAAGAAGTGTTTGCGGACAGACGCAATCCGGATATGGTAT
GCGAAATGACGCTTTGCGGAGAGTCGCACATCTTGTCCGAGTTTGATATTGCCTATGAGCCGGATAATTC
CTCGAAAGAATATATGGAAGCATACGCTGTGTTCTCGGAGCCGGTAAATGCGGAGGTAGAGAACTGGATA
ATGCAATCGAACAGAAAAGAGAACGGAGTAGTCCGATTCTACCGCAACAGCGATGCTATGGACGAAGGTG
CACTGTTCGAGATAAAATTCAGTGATGCAAGTTGCGTGCATTATCGCAATGTATCGCAGGGAGACGCATC
GGTAAAGACCATTGTGATGACTTTTCCGTCTGTCCGGATGGGAGGTGATGAATTTGAACTAAAACGATAA

Protein ID: 375358280
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1986
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2344781..2345188 [-]
Producthypothetical protein
NoteHcp
UniProt IDE1WVU3
KEGG IDbfg:BF638R_1986
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 135 a.a.     [Download]
>gi|375358280|ref|YP_005111052.1| hypothetical protein BF638R_1986 [Bacteroides fragilis 638R]
MQTHLYLHKENTDLPHDEYRGKYPLKHFDYGLSRNVGRKGEITSGLCGGEIRIVIDGFSDATLLGWLFDT
FRKEDGAIVTLDEHETTFAKLQFSGASVRSYRMNYDSRVKKGVVTIIVIEAKEIVTDNDLFFKNK
 
Nucleotide Sequence: 408 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2345188-2344781 Bacteroides fragilis 638R, complete genome
ATGCAAACGCACCTGTACCTTCATAAAGAGAACACCGACCTACCCCACGACGAGTACCGGGGGAAGTATC
CGCTGAAACACTTTGATTACGGATTGAGCCGTAATGTGGGGCGTAAAGGTGAAATCACTTCCGGCTTATG
CGGCGGAGAAATACGGATCGTCATTGACGGATTTTCCGACGCTACCCTGCTAGGATGGCTCTTTGACACC
TTCCGTAAAGAAGATGGGGCGATTGTTACACTGGATGAACACGAAACGACCTTTGCCAAACTGCAATTTT
CGGGCGCATCGGTAAGGAGCTATCGTATGAACTACGATTCGCGGGTTAAAAAAGGTGTGGTGACTATCAT
TGTGATAGAAGCCAAAGAGATTGTAACGGACAATGACTTATTTTTTAAAAACAAATAA

Protein ID: 375358283
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1989
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2346787..2347191 [-]
Producthypothetical protein
NoteHcp
UniProt IDE1WVU6
KEGG IDbfg:BF638R_1989
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 134 a.a.     [Download]
>gi|375358283|ref|YP_005111055.1| hypothetical protein BF638R_1989 [Bacteroides fragilis 638R]
MELFSLPKIDSDLTAWFILDGKEYEMSQFSISFGQSVDHKGQPQDEVRGGRMLVVLTQALPDNLYRWAMT
SSPKNGEIVFRSKTANSPLRIMFNNAYCVSFQRQVGNASGMISKLLISPDEILMNGISFDNHWG
 
Nucleotide Sequence: 405 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2347191-2346787 Bacteroides fragilis 638R, complete genome
ATGGAATTATTTAGTTTACCCAAAATAGACAGTGACCTGACCGCATGGTTCATCCTTGACGGCAAAGAGT
ATGAGATGAGCCAATTTAGCATAAGTTTCGGACAGTCGGTTGATCATAAAGGTCAACCGCAAGACGAAGT
CCGTGGCGGTAGAATGCTTGTTGTTTTGACGCAGGCGCTACCGGACAATCTTTATCGTTGGGCAATGACT
TCATCTCCTAAAAACGGGGAGATTGTATTTCGTTCTAAAACCGCCAATTCACCTTTGCGGATAATGTTTA
ATAATGCGTATTGTGTGAGTTTTCAGCGTCAGGTTGGTAATGCTTCCGGTATGATTTCAAAACTATTAAT
TTCTCCTGATGAGATTTTGATGAATGGAATTAGCTTTGATAATCACTGGGGTTAA

Protein ID: 375358284
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1990
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2347197..2347625 [-]
Producthypothetical protein
NoteHcp
UniProt IDE1WVU7
KEGG IDbfg:BF638R_1990
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|375358284|ref|YP_005111056.1| hypothetical protein BF638R_1990 [Bacteroides fragilis 638R]
MFGHKSFLRIGALSDSSISGLYKDSYELESCSFNFSQGVDTNGSPQTEVRGGTLYLTYSGLPQEDMFHWM
LGSTKYEDGAIVVCDDNNEPLEKIFFEQAACVGLEIDYVQQGKGYIQTKITLQARKIKVGETTLENRWTI
NK
 
Nucleotide Sequence: 429 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2347625-2347197 Bacteroides fragilis 638R, complete genome
ATGTTTGGACATAAAAGTTTTTTGAGGATAGGTGCTTTGAGCGATTCCAGTATTTCGGGATTGTACAAAG
ACAGTTACGAACTGGAGAGTTGCAGTTTCAACTTCTCACAAGGGGTAGACACTAACGGCAGTCCGCAGAC
AGAGGTTCGTGGTGGTACACTTTATCTCACCTATAGCGGATTGCCTCAGGAAGATATGTTTCACTGGATG
TTAGGTTCGACAAAATACGAAGATGGAGCCATTGTTGTGTGTGATGACAATAATGAGCCTTTAGAGAAAA
TTTTCTTTGAGCAGGCAGCTTGCGTTGGTTTGGAGATAGATTATGTCCAACAAGGAAAAGGATATATACA
AACTAAGATAACATTACAGGCACGTAAAATCAAAGTGGGTGAAACTACCCTTGAAAATCGTTGGACAATA
AATAAATAG

Protein ID: 375358288
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1994
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2352070..2352459 [-]
Producthypothetical protein
NoteHcp
UniProt IDE1WVV1
KEGG IDbfg:BF638R_1994
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 129 a.a.     [Download]
>gi|375358288|ref|YP_005111060.1| hypothetical protein BF638R_1994 [Bacteroides fragilis 638R]
MAFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILENMTNQFKPHSGSIV
FKKGDEEAKMKELTWENGYITEFTENIDIVGSQPMTITFVVSAQVIKIGGAQFEQNWPK
 
Nucleotide Sequence: 390 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2352459-2352070 Bacteroides fragilis 638R, complete genome
ATGGCATTTAGAGCAACCTTAAGCTTTGCAGGAAAAGAGTTTGACGTGCTGGATTGCACGTACAGTCTCA
AGCGAGATGTGGATTCCAAAGGACGCCCATCTTCAAACATTTATGGTGGACAAATTCGTCTGCATGTGGA
ATCGACTGATGATACTTCCATTCTGGAGAACATGACCAATCAGTTTAAACCTCATTCCGGCAGCATCGTC
TTCAAAAAAGGAGATGAAGAAGCCAAGATGAAGGAACTTACCTGGGAAAACGGATACATTACCGAATTTA
CCGAAAACATCGACATTGTCGGCTCGCAGCCGATGACTATCACTTTTGTCGTATCGGCTCAGGTAATCAA
GATTGGTGGCGCACAATTTGAACAGAATTGGCCGAAGTAA