SecReT6
Protein ID: 375358280
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1986
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2344781..2345188 [-]
Producthypothetical protein
NoteHcp
UniProt IDE1WVU3
KEGG IDbfg:BF638R_1986
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 135 a.a.     [Download]
>gi|375358280|ref|YP_005111052.1| hypothetical protein BF638R_1986 [Bacteroides fragilis 638R]
MQTHLYLHKENTDLPHDEYRGKYPLKHFDYGLSRNVGRKGEITSGLCGGEIRIVIDGFSDATLLGWLFDT
FRKEDGAIVTLDEHETTFAKLQFSGASVRSYRMNYDSRVKKGVVTIIVIEAKEIVTDNDLFFKNK
 
Nucleotide Sequence: 408 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2345188-2344781 Bacteroides fragilis 638R, complete genome
ATGCAAACGCACCTGTACCTTCATAAAGAGAACACCGACCTACCCCACGACGAGTACCGGGGGAAGTATC
CGCTGAAACACTTTGATTACGGATTGAGCCGTAATGTGGGGCGTAAAGGTGAAATCACTTCCGGCTTATG
CGGCGGAGAAATACGGATCGTCATTGACGGATTTTCCGACGCTACCCTGCTAGGATGGCTCTTTGACACC
TTCCGTAAAGAAGATGGGGCGATTGTTACACTGGATGAACACGAAACGACCTTTGCCAAACTGCAATTTT
CGGGCGCATCGGTAAGGAGCTATCGTATGAACTACGATTCGCGGGTTAAAAAAGGTGTGGTGACTATCAT
TGTGATAGAAGCCAAAGAGATTGTAACGGACAATGACTTATTTTTTAAAAACAAATAA