SecReT6
Protein ID: 375358283
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1989
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2346787..2347191 [-]
Producthypothetical protein
NoteHcp
UniProt IDE1WVU6
KEGG IDbfg:BF638R_1989
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 134 a.a.     [Download]
>gi|375358283|ref|YP_005111055.1| hypothetical protein BF638R_1989 [Bacteroides fragilis 638R]
MELFSLPKIDSDLTAWFILDGKEYEMSQFSISFGQSVDHKGQPQDEVRGGRMLVVLTQALPDNLYRWAMT
SSPKNGEIVFRSKTANSPLRIMFNNAYCVSFQRQVGNASGMISKLLISPDEILMNGISFDNHWG
 
Nucleotide Sequence: 405 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2347191-2346787 Bacteroides fragilis 638R, complete genome
ATGGAATTATTTAGTTTACCCAAAATAGACAGTGACCTGACCGCATGGTTCATCCTTGACGGCAAAGAGT
ATGAGATGAGCCAATTTAGCATAAGTTTCGGACAGTCGGTTGATCATAAAGGTCAACCGCAAGACGAAGT
CCGTGGCGGTAGAATGCTTGTTGTTTTGACGCAGGCGCTACCGGACAATCTTTATCGTTGGGCAATGACT
TCATCTCCTAAAAACGGGGAGATTGTATTTCGTTCTAAAACCGCCAATTCACCTTTGCGGATAATGTTTA
ATAATGCGTATTGTGTGAGTTTTCAGCGTCAGGTTGGTAATGCTTCCGGTATGATTTCAAAACTATTAAT
TTCTCCTGATGAGATTTTGATGAATGGAATTAGCTTTGATAATCACTGGGGTTAA