SecReT6
Protein ID: 375358284
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1990
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2347197..2347625 [-]
Producthypothetical protein
NoteHcp
UniProt IDE1WVU7
KEGG IDbfg:BF638R_1990
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 142 a.a.     [Download]
>gi|375358284|ref|YP_005111056.1| hypothetical protein BF638R_1990 [Bacteroides fragilis 638R]
MFGHKSFLRIGALSDSSISGLYKDSYELESCSFNFSQGVDTNGSPQTEVRGGTLYLTYSGLPQEDMFHWM
LGSTKYEDGAIVVCDDNNEPLEKIFFEQAACVGLEIDYVQQGKGYIQTKITLQARKIKVGETTLENRWTI
NK
 
Nucleotide Sequence: 429 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2347625-2347197 Bacteroides fragilis 638R, complete genome
ATGTTTGGACATAAAAGTTTTTTGAGGATAGGTGCTTTGAGCGATTCCAGTATTTCGGGATTGTACAAAG
ACAGTTACGAACTGGAGAGTTGCAGTTTCAACTTCTCACAAGGGGTAGACACTAACGGCAGTCCGCAGAC
AGAGGTTCGTGGTGGTACACTTTATCTCACCTATAGCGGATTGCCTCAGGAAGATATGTTTCACTGGATG
TTAGGTTCGACAAAATACGAAGATGGAGCCATTGTTGTGTGTGATGACAATAATGAGCCTTTAGAGAAAA
TTTTCTTTGAGCAGGCAGCTTGCGTTGGTTTGGAGATAGATTATGTCCAACAAGGAAAAGGATATATACA
AACTAAGATAACATTACAGGCACGTAAAATCAAAGTGGGTGAAACTACCCTTGAAAATCGTTGGACAATA
AATAAATAG