SecReT6
Protein ID: 375358285
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1991
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2347641..2350124 [-]
Productputative ATP-dependent protease
NoteClpV
UniProt IDE1WVU8
KEGG IDbfg:BF638R_1991
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.50E-45, Aligned region: 211..290
AAA_2 [PF07724], Evalue: 3.50E-45, Aligned region: 566..728
AAA [PF00004], Evalue: 3.50E-20, Aligned region: 212..342
AAA [PF00004], Evalue: 3.50E-20, Aligned region: 571..688
ClpB_D2-small [PF10431], Evalue: 7.60E-18, Aligned region: 735..814
AAA_5 [PF07728], Evalue: 6.80E-17, Aligned region: 211..291
AAA_5 [PF07728], Evalue: 6.80E-17, Aligned region: 570..691
AAA_16 [PF13191], Evalue: 3.00E-15, Aligned region: 190..230
AAA_16 [PF13191], Evalue: 3.00E-15, Aligned region: 257..292
AAA_16 [PF13191], Evalue: 3.00E-15, Aligned region: 538..606
AAA_22 [PF13401], Evalue: 6.00E-09, Aligned region: 210..305
AAA_22 [PF13401], Evalue: 6.00E-09, Aligned region: 568..595
Sigma54_activat [PF00158], Evalue: 1.40E-08, Aligned region: 210..229
Sigma54_activat [PF00158], Evalue: 1.40E-08, Aligned region: 569..681
AAA_14 [PF13173], Evalue: 7.00E-08, Aligned region: 210..313
AAA_14 [PF13173], Evalue: 7.00E-08, Aligned region: 571..666
NACHT [PF05729], Evalue: 1.70E-07, Aligned region: 212..240
NACHT [PF05729], Evalue: 1.70E-07, Aligned region: 571..654
IstB_IS21 [PF01695], Evalue: 6.10E-06, Aligned region: 210..235
IstB_IS21 [PF01695], Evalue: 6.10E-06, Aligned region: 570..598
AAA_18 [PF13238], Evalue: 8.90E-06, Aligned region: 212..289
AAA_18 [PF13238], Evalue: 8.90E-06, Aligned region: 572..599
AAA_24 [PF13479], Evalue: 7.80E-05, Aligned region: 211..227
AAA_24 [PF13479], Evalue: 7.80E-05, Aligned region: 469..493
AAA_24 [PF13479], Evalue: 7.80E-05, Aligned region: 571..592
AAA_19 [PF13245], Evalue: 8.70E-05, Aligned region: 208..232
AAA_19 [PF13245], Evalue: 8.70E-05, Aligned region: 570..593
Zeta_toxin [PF06414], Evalue: 9.20E-05, Aligned region: 212..226
Zeta_toxin [PF06414], Evalue: 9.20E-05, Aligned region: 299..338
Zeta_toxin [PF06414], Evalue: 9.20E-05, Aligned region: 569..624
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 193..226
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 266..296
Arch_ATPase [PF01637], Evalue: 0.00019, Aligned region: 570..599
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 209..230
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 569..587
AAA_25 [PF13481], Evalue: 0.00022, Aligned region: 212..237
AAA_25 [PF13481], Evalue: 0.00022, Aligned region: 569..593
AAA_17 [PF13207], Evalue: 0.00024, Aligned region: 212..252
AAA_17 [PF13207], Evalue: 0.00024, Aligned region: 573..605
RNA_helicase [PF00910], Evalue: 0.00027, Aligned region: 212..235
RNA_helicase [PF00910], Evalue: 0.00027, Aligned region: 571..594
Mg_chelatase [PF01078], Evalue: 0.00036, Aligned region: 196..231
Mg_chelatase [PF01078], Evalue: 0.00036, Aligned region: 570..592
PhoH [PF02562], Evalue: 0.00047, Aligned region: 195..232
PhoH [PF02562], Evalue: 0.00047, Aligned region: 570..596
MobB [PF03205], Evalue: 0.0007, Aligned region: 211..247
MobB [PF03205], Evalue: 0.0007, Aligned region: 573..597
ABC_tran [PF00005], Evalue: 0.0011, Aligned region: 212..237
ABC_tran [PF00005], Evalue: 0.0011, Aligned region: 571..608
FtsK_SpoIIIE [PF01580], Evalue: 0.0011, Aligned region: 208..240
FtsK_SpoIIIE [PF01580], Evalue: 0.0011, Aligned region: 573..593
UPF0079 [PF02367], Evalue: 0.0013, Aligned region: 212..233
UPF0079 [PF02367], Evalue: 0.0013, Aligned region: 571..594
DUF87 [PF01935], Evalue: 0.0015, Aligned region: 212..235
DUF87 [PF01935], Evalue: 0.0015, Aligned region: 486..502
DUF87 [PF01935], Evalue: 0.0015, Aligned region: 572..603
T2SE [PF00437], Evalue: 0.0018, Aligned region: 197..227
T2SE [PF00437], Evalue: 0.0018, Aligned region: 567..619
T2SE [PF00437], Evalue: 0.0018, Aligned region: 786..814
Miro [PF08477], Evalue: 0.0019, Aligned region: 212..232
Miro [PF08477], Evalue: 0.0019, Aligned region: 570..593
AAA_10 [PF12846], Evalue: 0.0027, Aligned region: 210..230
AAA_10 [PF12846], Evalue: 0.0027, Aligned region: 278..298
AAA_10 [PF12846], Evalue: 0.0027, Aligned region: 398..442
AAA_10 [PF12846], Evalue: 0.0027, Aligned region: 569..593
RuvB_N [PF05496], Evalue: 0.0031, Aligned region: 267..292
RuvB_N [PF05496], Evalue: 0.0031, Aligned region: 539..591
RuvB_N [PF05496], Evalue: 0.0031, Aligned region: 639..671
AAA_28 [PF13521], Evalue: 0.0035, Aligned region: 212..252
AAA_28 [PF13521], Evalue: 0.0035, Aligned region: 571..590
DUF258 [PF03193], Evalue: 0.0051, Aligned region: 189..231
DUF258 [PF03193], Evalue: 0.0051, Aligned region: 571..590
AAA_30 [PF13604], Evalue: 0.0091, Aligned region: 210..230
AAA_30 [PF13604], Evalue: 0.0091, Aligned region: 408..434
AAA_30 [PF13604], Evalue: 0.0091, Aligned region: 572..596
PduV-EutP [PF10662], Evalue: 0.0095, Aligned region: 211..232
PduV-EutP [PF10662], Evalue: 0.0095, Aligned region: 571..593
AAA_23 [PF13476], Evalue: 0.0097, Aligned region: 209..241
AAA_23 [PF13476], Evalue: 0.0097, Aligned region: 570..606
Protein Sequence: 827 a.a.     [Download]
>gi|375358285|ref|YP_005111057.1| putative ATP-dependent protease [Bacteroides fragilis 638R]
MDFLNINETVQSVIRISKGVAREYGNASYAPAHLLFALMHKEVGLRSFVESLGKDADYLREWAEVRIEEY
PKAAGAGEIMPDPKVSELFEQADNVRIKWGLLEINPLCLLAAIATPEAGFSTDELRSFPIREREIHDLFT
SGMGNMKKSVSTQTDLPGIEAPLWTAGAGNLDKYCTDKTALAADKKVYPIVCRDRETRMMMEILGRMGKP
NVLIIGDAGVGKTALVDGLACSIIEGTVPQYLKDMTIYELDTGTLIAGATYKGEIEERLKGIIKELSAHG
NAILFIDEIHTLIDPKSGNSGAASILKPELAKGNITVIGVTTVDEYRKLIEPDHALNRRFEVLQVSEPDL
ASTVNMIQAALERYESYHGVGVDVDSLPECVALAKRYVKERRLPDAAIDLIDRTLSAVKMINQSGEKDIK
GLAEQLAAIEAAEDQPEAERTEKLRLVNFTMKNRLSPILLGMLSDGQNEPESSDYGEWMDYILSVLDRLR
ELTKEKIGKITSHEVAAVVSSSTGIPIGKIESGEKEKLLNMEDILRRRVVGQDNALKVLTDAIVESRSGM
NKPGQPIGSFFLLGPTGTGKTELAKTLAEALFNDEKAMIRFDMSEFKEEHSAALLLGAPPGYVGYEEGGV
LVNRIRRQPYAVVLFDEIEKAHSSVYDIFLQIMDEGKLHDRLGKEGDFSNSIVLFTSNVGSEWLSKQINE
GKNPSTTDLMEVMGSYFRPEFLARLSEIVPFSPINETMLVRIFEIQLKGVIALLEKQHIDIEITEKAKNL
LATRGFTPKYGARQVAGTIRNYIRRPISKMIVAGTLTAGNTVVVDVADNGDIDWNVK
 
Nucleotide Sequence: 2484 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2350124-2347641 Bacteroides fragilis 638R, complete genome
ATGGATTTTTTGAACATCAATGAAACAGTTCAGAGCGTAATCCGAATATCAAAAGGTGTCGCCCGTGAGT
ATGGCAATGCCAGCTATGCTCCGGCACACCTTTTGTTTGCCTTGATGCACAAAGAGGTAGGTCTGCGTTC
GTTTGTCGAATCGTTGGGTAAGGATGCGGATTACTTGCGCGAATGGGCGGAGGTAAGAATAGAGGAGTAC
CCCAAGGCTGCCGGCGCAGGCGAGATAATGCCCGATCCGAAAGTTAGCGAACTGTTTGAGCAAGCCGATA
ATGTACGAATCAAGTGGGGACTGCTGGAAATCAATCCACTTTGCCTGCTGGCAGCCATTGCTACACCCGA
AGCAGGTTTCAGTACGGACGAGTTGCGCTCGTTCCCTATTCGGGAGCGTGAGATACATGACCTCTTCACG
AGCGGAATGGGTAATATGAAAAAATCCGTAAGTACGCAGACTGACCTTCCGGGGATTGAAGCCCCCCTAT
GGACAGCCGGGGCGGGCAATTTAGATAAGTACTGTACGGATAAGACTGCTCTTGCGGCAGACAAGAAAGT
ATATCCTATCGTGTGCCGTGACCGTGAGACACGCATGATGATGGAAATTCTGGGGCGGATGGGTAAGCCC
AACGTGCTCATCATCGGCGATGCCGGTGTGGGTAAGACTGCCTTGGTAGACGGTTTGGCATGCAGCATCA
TTGAGGGTACAGTTCCCCAATATCTAAAGGACATGACTATCTATGAGCTTGACACAGGAACACTGATTGC
GGGTGCTACCTACAAAGGGGAGATAGAAGAACGGCTGAAAGGAATCATCAAAGAATTGTCGGCTCACGGC
AATGCGATTCTCTTCATTGATGAAATACATACGCTGATCGACCCCAAGTCGGGCAACAGCGGAGCGGCAA
GCATCCTGAAGCCGGAGCTTGCCAAAGGAAATATAACGGTAATCGGAGTCACTACGGTGGACGAATACCG
TAAACTAATTGAACCGGACCATGCCCTTAACCGGCGTTTTGAAGTATTGCAAGTATCGGAACCTGACCTT
GCATCCACCGTAAATATGATACAGGCAGCTTTGGAAAGATATGAAAGCTACCACGGTGTGGGGGTAGATG
TAGATTCGTTGCCGGAATGCGTGGCACTCGCCAAGCGTTATGTCAAGGAACGCCGTTTGCCGGATGCCGC
TATTGATTTGATAGACCGTACCCTCTCTGCGGTTAAGATGATTAACCAGAGCGGGGAAAAAGATATAAAG
GGACTGGCAGAGCAGCTTGCCGCAATTGAAGCGGCGGAAGACCAGCCCGAAGCGGAGCGCACGGAGAAGT
TGCGGTTAGTCAATTTCACCATGAAGAACCGGTTAAGCCCTATCCTTCTGGGAATGCTCTCCGATGGACA
GAATGAACCGGAGTCATCAGACTACGGTGAATGGATGGATTATATTTTAAGTGTACTTGACCGATTACGT
GAATTGACCAAAGAGAAAATCGGGAAAATCACTTCCCATGAAGTGGCAGCCGTTGTTTCTTCTTCTACAG
GTATCCCTATCGGCAAGATAGAGTCGGGCGAGAAAGAAAAGTTACTCAACATGGAAGATATTCTGCGTCG
TAGAGTGGTGGGACAGGATAATGCGCTGAAGGTATTGACAGATGCCATTGTCGAATCACGAAGTGGAATG
AACAAACCGGGACAACCGATTGGCTCATTCTTCCTGCTGGGACCTACCGGAACCGGTAAGACCGAGTTGG
CAAAAACATTGGCAGAAGCACTTTTCAATGACGAAAAGGCGATGATTCGTTTTGATATGTCAGAGTTTAA
GGAAGAACATTCGGCAGCCCTGCTATTGGGAGCGCCTCCGGGATACGTGGGCTACGAAGAAGGTGGCGTA
CTCGTGAACCGGATACGTCGTCAGCCTTATGCGGTGGTGCTTTTCGATGAGATAGAGAAAGCCCATTCTT
CCGTTTATGACATCTTCCTGCAAATCATGGACGAAGGCAAGCTACACGACCGTTTGGGCAAAGAGGGGGA
TTTTTCCAATTCTATCGTACTGTTTACGTCCAATGTAGGTAGCGAATGGCTTAGCAAGCAGATTAATGAG
GGTAAGAATCCTTCTACCACTGACCTGATGGAAGTCATGGGCAGTTATTTCCGTCCGGAGTTTCTTGCCC
GTTTGTCGGAAATCGTGCCTTTCTCTCCTATTAACGAAACAATGCTGGTTCGTATCTTTGAGATACAGTT
AAAGGGAGTTATAGCATTGCTTGAGAAGCAGCATATTGACATTGAGATTACGGAGAAGGCAAAGAACCTG
CTTGCTACCCGTGGCTTCACTCCGAAATACGGAGCACGTCAGGTGGCGGGTACGATACGTAACTATATCC
GCCGTCCTATCTCAAAGATGATTGTTGCAGGAACATTGACGGCAGGGAATACAGTTGTTGTCGATGTGGC
GGATAATGGAGATATTGATTGGAATGTGAAATGA