SecReT6
Protein ID: 375358286
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1992
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2350137..2351516 [-]
Producthypothetical protein
NoteTssC
UniProt IDE1WVU9
KEGG IDbfg:BF638R_1992
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-35, Aligned region: 116..441
Phage_sheath_1 [PF04984], Evalue: 0.0016, Aligned region: 129..157
Phage_sheath_1 [PF04984], Evalue: 0.0016, Aligned region: 290..438
Protein Sequence: 459 a.a.     [Download]
>gi|375358286|ref|YP_005111058.1| hypothetical protein BF638R_1992 [Bacteroides fragilis 638R]
MEDNKNKSEVQAQETVQVSYKEKNGESSLASALDVLSRFGGFNFLESTVDGVQNLNPERKARKKIFLTDE
QKQEEREVLKNKIDMWIDLLNSSSAVTEMIATSKAKSEAAASHLAKSQLVAVQSVRDMEQAYRGVMLFYK
NTEADKVNNVTIVNASKEQLTDLDNPRFIDFVARELKQNYDKLDLRQNYSLLAIPGYLGSNKVLEKWAKI
AYENKVMLYTDFADLDKPEDVVELFSSSNMASGEAFKSNTCMTCNWLVGRAGYREIGEEEDLHVSPSIAL
MGKVYTTLMSQVTAGKKYGGINEIDAVVFPLKKSEISQLEKMGLIPMVNEYGKVMAFSAKTLFNGDNLGL
QTYSVVRVFDYITKVLFDFLNRRSFENWSSKTERDLRGQIVQYLDSVQGADRLIEKFKIIRFEQDQKQKD
RIYLDIHMTPFFPAKSFVIKLDGTKGDDGTNWNTNYEQA
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2351516-2350137 Bacteroides fragilis 638R, complete genome
ATGGAAGATAATAAAAATAAGTCTGAAGTTCAGGCGCAAGAAACCGTTCAAGTTTCCTATAAAGAGAAAA
ACGGGGAATCCTCTCTGGCTTCGGCACTGGATGTGTTGTCCAGATTCGGCGGTTTCAATTTTCTGGAATC
AACAGTAGATGGTGTTCAGAACCTGAACCCCGAGCGTAAGGCACGCAAAAAGATATTCTTAACCGATGAA
CAGAAGCAAGAAGAACGGGAAGTGCTGAAGAATAAGATAGATATGTGGATCGACCTGCTGAACTCATCAT
CGGCAGTGACGGAAATGATTGCCACTTCTAAAGCTAAATCGGAAGCTGCCGCATCGCATCTTGCCAAAAG
CCAATTGGTGGCAGTGCAGAGTGTGAGGGATATGGAACAGGCATACCGTGGAGTGATGTTGTTCTATAAG
AATACGGAAGCGGACAAAGTGAACAACGTGACGATAGTCAATGCTTCCAAAGAACAACTGACCGACCTCG
ACAATCCCCGCTTCATTGATTTCGTTGCCCGCGAACTGAAACAGAACTATGACAAGTTGGATTTACGTCA
AAATTACTCACTGTTAGCCATTCCGGGCTATCTTGGTTCGAATAAGGTGCTTGAAAAATGGGCGAAAATC
GCTTATGAAAATAAAGTGATGCTCTATACGGACTTTGCCGACCTTGATAAGCCGGAAGATGTGGTGGAAC
TGTTCTCTTCCTCCAATATGGCAAGTGGGGAGGCCTTCAAAAGCAATACCTGCATGACCTGCAACTGGCT
GGTGGGACGTGCCGGATACCGGGAAATCGGTGAAGAGGAAGACCTCCATGTTTCTCCGTCTATTGCTTTG
ATGGGTAAAGTTTACACCACTCTGATGTCTCAGGTAACTGCCGGTAAGAAGTATGGCGGCATTAATGAAA
TAGATGCGGTGGTATTCCCGTTGAAGAAAAGCGAAATCTCACAACTGGAGAAAATGGGTTTAATTCCGAT
GGTTAATGAATATGGTAAAGTGATGGCGTTCTCCGCAAAGACATTGTTCAACGGTGACAATCTGGGATTG
CAAACTTATTCTGTGGTACGTGTATTCGACTATATTACCAAGGTGTTGTTTGATTTCCTGAACCGCCGTT
CGTTCGAGAACTGGAGCTCTAAAACCGAACGTGACCTGAGAGGGCAGATTGTACAGTATCTTGATAGTGT
ACAGGGAGCCGACCGCCTTATCGAAAAATTCAAGATAATCCGTTTCGAGCAAGACCAAAAGCAGAAGGAC
CGTATTTATCTGGATATTCACATGACTCCGTTCTTCCCTGCCAAGAGCTTTGTTATCAAGTTGGACGGCA
CGAAAGGTGATGATGGTACAAACTGGAATACAAATTACGAACAGGCGTAA