SecReT6
Protein ID: 375358287
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1993
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2351532..2351981 [-]
Producthypothetical protein
NoteTssB
UniProt IDE1WVV0
KEGG IDbfg:BF638R_1993
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 149 a.a.     [Download]
>gi|375358287|ref|YP_005111059.1| hypothetical protein BF638R_1993 [Bacteroides fragilis 638R]
MAILEYGIGGNEVKVDTSEAIANIPENRSLIVEQLTADEPVTPEAVKGLSTIEEVFAHFLPNIDVEFENE
EGQPVKENFRFSSVADFSVKNMTQNSPFLHKLDTEKTFYEGMVTQLRSNKVLQRVLENPESKKAFISALE
ALSNELKTE
 
Nucleotide Sequence: 450 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2351981-2351532 Bacteroides fragilis 638R, complete genome
ATGGCAATACTTGAATATGGAATTGGTGGTAATGAAGTGAAAGTTGATACTTCCGAAGCCATCGCAAACA
TTCCGGAGAATCGCTCCCTCATAGTTGAACAGTTAACTGCTGACGAACCTGTAACTCCTGAAGCGGTCAA
AGGCTTAAGCACTATCGAAGAGGTGTTTGCGCACTTCTTGCCCAACATTGATGTTGAATTTGAAAATGAA
GAAGGGCAACCGGTAAAAGAAAACTTTAGATTTAGCTCAGTGGCGGACTTCAGTGTGAAGAATATGACAC
AGAATAGTCCATTCCTCCATAAGTTGGATACGGAGAAAACATTCTACGAGGGGATGGTGACACAATTGCG
TTCTAATAAAGTTCTACAACGAGTGTTGGAGAATCCGGAATCCAAAAAGGCGTTTATCAGCGCACTGGAG
GCATTGAGTAACGAATTAAAGACCGAATAA