SecReT6
Protein ID: 375358288
SecReT6 ID926
T6SS typeiii
Gene symbol-
Locus tagBF638R_1994
StrainBacteroides fragilis 638R
Repliconchromosome [GenBank: NC_016776] [Browse all T6SS(s) in this replicon]
Location [Strand]2352070..2352459 [-]
Producthypothetical protein
NoteHcp
UniProt IDE1WVV1
KEGG IDbfg:BF638R_1994
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 129 a.a.     [Download]
>gi|375358288|ref|YP_005111060.1| hypothetical protein BF638R_1994 [Bacteroides fragilis 638R]
MAFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILENMTNQFKPHSGSIV
FKKGDEEAKMKELTWENGYITEFTENIDIVGSQPMTITFVVSAQVIKIGGAQFEQNWPK
 
Nucleotide Sequence: 390 bp     [Download]
>gi|375356399|ref|NC_016776.1|:c2352459-2352070 Bacteroides fragilis 638R, complete genome
ATGGCATTTAGAGCAACCTTAAGCTTTGCAGGAAAAGAGTTTGACGTGCTGGATTGCACGTACAGTCTCA
AGCGAGATGTGGATTCCAAAGGACGCCCATCTTCAAACATTTATGGTGGACAAATTCGTCTGCATGTGGA
ATCGACTGATGATACTTCCATTCTGGAGAACATGACCAATCAGTTTAAACCTCATTCCGGCAGCATCGTC
TTCAAAAAAGGAGATGAAGAAGCCAAGATGAAGGAACTTACCTGGGAAAACGGATACATTACCGAATTTA
CCGAAAACATCGACATTGTCGGCTCGCAGCCGATGACTATCACTTTTGTCGTATCGGCTCAGGTAATCAA
GATTGGTGGCGCACAATTTGAACAGAATTGGCCGAAGTAA