SecReT6
Protein ID: 377807393
SecReT6 ID515
T6SS typeN/A
Gene symbol-
Locus tagBYI23_C000010
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]5369..5773 [-]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDG8MIF3
KEGG IDbyi:BYI23_C000010
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-16, Aligned region: 19..103
Protein Sequence: 134 a.a.     [Download]
>gi|377807393|ref|YP_004978585.1| GPW/gp25 family protein [Burkholderia sp. YI23]
MRTDGRSIDEFTPEEQTFYSVRDNIQRILNSRRKALAHLPQYGLDDLSEIYRHLPASAHKLQNEIEATLL
QYEPRLQSIEIEINEPEPGMLLSFTMACHLRREGLVRFGTHFTPDGRTRLRMLNSTIDQDRSIA
 
Nucleotide Sequence: 405 bp     [Download]
>gi|377807392|ref|NC_016590.1|:c5773-5369 Burkholderia sp. YI23 chromosome 3, complete sequence
ATACGCACCGATGGACGATCCATCGATGAATTCACGCCCGAGGAGCAGACGTTTTATTCGGTGCGGGACA
ACATCCAGCGAATATTGAATAGCCGGCGCAAGGCGCTTGCGCATCTGCCGCAATATGGGCTCGACGATCT
GTCGGAGATCTATCGGCATCTGCCGGCGTCGGCGCACAAGTTGCAGAACGAAATCGAAGCGACGCTGTTG
CAATACGAGCCGCGTTTGCAATCGATCGAGATCGAAATTAATGAGCCAGAGCCGGGTATGCTGCTCAGCT
TCACGATGGCGTGTCATCTACGCCGCGAGGGTCTCGTGCGATTTGGCACGCACTTCACGCCGGATGGCAG
GACACGGCTACGAATGCTGAACTCGACAATCGATCAGGACCGATCTATCGCGTAA