SecReT6
Protein ID: 377807400
SecReT6 ID515
T6SS typeN/A
Gene symbol-
Locus tagBYI23_C000080
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]11908..12570 [-]
Producthypothetical protein
NoteTssL
UniProt IDG8MIG0
KEGG IDbyi:BYI23_C000080
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-34, Aligned region: 11..212
Protein Sequence: 220 a.a.     [Download]
>gi|377807400|ref|YP_004978592.1| hypothetical protein BYI23_C000080 [Burkholderia sp. YI23]
MSAISDVLPVALRDTALTVSDLYQASGRSSEWAKQVLKDCVEQITRLKAELQTRGLSPDQIDDAVCAQCA
LLDEVALRNLEGDARNEWERNPLQLAELKVNDAGEELVRRIEQRLRDAQPARLLLAIFAAVLDLGFTGRL
ALDGHDARARLRPALDERLGVTSQSDDSNEDGAVIVRAPVTRTWGQRISPLGCVALACVAMSLIWFAIDS
WLDASVRAMH
 
Nucleotide Sequence: 663 bp     [Download]
>gi|377807392|ref|NC_016590.1|:c12570-11908 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAGCGCCATAAGCGATGTGCTGCCCGTCGCGCTGCGCGATACCGCATTGACGGTCTCCGATCTGTATC
AGGCGAGCGGCCGTTCGTCCGAGTGGGCGAAGCAGGTTCTGAAGGATTGCGTCGAACAGATCACCCGTTT
GAAGGCGGAACTGCAAACGCGTGGATTATCGCCCGATCAGATCGACGATGCCGTCTGTGCGCAGTGCGCT
CTGCTCGATGAGGTCGCGTTGCGCAATCTCGAAGGCGATGCGCGTAACGAGTGGGAGCGAAATCCGTTGC
AGTTGGCCGAATTGAAGGTCAACGATGCGGGCGAGGAACTCGTGCGGCGCATCGAACAGCGTCTGCGTGA
CGCACAGCCCGCGAGACTTTTGCTTGCGATATTCGCTGCGGTGCTGGACCTGGGCTTCACGGGCCGGCTT
GCGCTCGACGGCCATGACGCGCGTGCACGGCTACGGCCTGCTCTCGATGAACGGCTCGGCGTAACGAGCC
AATCTGACGATTCAAATGAGGATGGCGCCGTTATCGTCAGGGCGCCTGTCACACGGACGTGGGGCCAGCG
AATTTCCCCGCTCGGATGCGTGGCGCTCGCTTGCGTGGCAATGAGCCTGATCTGGTTCGCGATCGACAGT
TGGCTCGACGCGTCGGTCCGCGCGATGCATTGA