SecReT6
Protein ID: 377807401
SecReT6 ID515
T6SS typeN/A
Gene symbol-
Locus tagBYI23_C000090
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]12567..13913 [-]
Producthypothetical protein
NoteTssK
UniProt IDG8MIG1
KEGG IDbyi:BYI23_C000090
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.20E-133, Aligned region: 18..445
Protein Sequence: 448 a.a.     [Download]
>gi|377807401|ref|YP_004978593.1| hypothetical protein BYI23_C000090 [Burkholderia sp. YI23]
MKIARPLWAQGVFMTPQHFQQQALWEQFSNQRIATMASADPWGVVNVVLDTQSLGINRLQLTALSLRLPD
GTLIDSETSDWLPAARNLDDVPSQHDAVTVLAAVALVDAQGHNCVEPGTKPARPRRFVREYLHVADVNGD
GKEEISVERHAVSLLLDFEETGDYVTCPVARLIRNAQGRFELDASFVPPCLFLSANATLTARMKRLSEIL
SAKSTSLAVRRRERSDQIADYAVADVSLFWLLHSVNSSWPELARLAQAPDQHPERLYTLLARLAGSLLTF
STTETLQAIPAYDHMTPEPVFAELESLIRNLLDTVIPSRVVPIALQRVRGTMWTGLIEDERLADDADYYL
SVQAALPVHTLIEQFPRLCKAGAPDEVEQIVNSALSGIPIKPMSRLPAAIPVRIENQYFALDSAHPAFKR
MIAAHACQFYVPASIPDVSIELYAVLPT
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|377807392|ref|NC_016590.1|:c13913-12567 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAAAATAGCTCGACCCTTGTGGGCACAAGGCGTCTTTATGACGCCGCAACACTTCCAGCAGCAAGCGC
TATGGGAGCAGTTCTCCAATCAGCGCATCGCCACGATGGCCAGCGCGGACCCTTGGGGCGTCGTCAATGT
CGTACTCGACACACAGTCGCTCGGCATCAATCGCCTGCAACTCACGGCCCTTTCGCTGCGCCTGCCCGAT
GGCACGCTGATCGACAGCGAGACCTCGGACTGGCTGCCCGCTGCACGAAACCTCGACGATGTCCCGTCCC
AACACGATGCCGTGACGGTGCTCGCGGCCGTGGCGCTCGTCGATGCGCAGGGCCACAACTGCGTGGAGCC
GGGCACGAAGCCGGCAAGGCCGCGCCGGTTCGTGCGCGAATATCTGCACGTCGCGGATGTCAACGGCGAC
GGCAAGGAAGAGATCAGCGTCGAGCGCCACGCGGTGTCGCTGCTGCTCGACTTCGAGGAAACGGGCGATT
ATGTGACCTGCCCCGTCGCGCGGCTCATTCGCAACGCGCAGGGCCGCTTCGAGCTCGATGCATCGTTCGT
ACCGCCGTGCCTCTTCCTCTCGGCGAACGCGACGCTGACCGCACGCATGAAACGCCTGTCGGAAATCCTG
AGCGCGAAGAGCACGAGTCTAGCCGTGCGCCGCCGCGAGCGCTCGGATCAGATCGCCGACTATGCCGTGG
CCGACGTGTCGCTTTTCTGGCTGCTGCACAGCGTCAACTCGTCGTGGCCAGAGCTGGCGCGCCTGGCTCA
GGCGCCGGATCAGCATCCCGAGCGGCTCTATACGCTGCTGGCGCGGCTCGCCGGCTCGCTTCTGACGTTC
TCCACCACCGAGACCTTGCAGGCCATTCCGGCCTACGATCATATGACGCCGGAGCCTGTATTCGCAGAGC
TGGAATCGCTGATCCGCAACCTGCTCGACACGGTGATTCCGTCGCGCGTGGTGCCCATCGCGCTGCAACG
TGTGCGCGGGACAATGTGGACGGGGCTCATCGAGGACGAGCGCCTGGCCGACGATGCGGACTATTATCTA
TCCGTCCAGGCCGCGCTGCCGGTGCATACGCTCATCGAGCAGTTCCCGCGTCTGTGCAAGGCGGGCGCGC
CCGATGAAGTCGAACAGATCGTCAACTCGGCGCTCTCGGGCATTCCGATCAAGCCGATGTCGCGCCTGCC
CGCGGCCATTCCCGTGCGCATCGAGAATCAGTATTTCGCGCTGGACTCGGCGCATCCGGCGTTCAAACGC
ATGATCGCGGCGCACGCCTGCCAGTTCTACGTGCCCGCCTCGATTCCCGACGTATCGATCGAACTCTACG
CGGTGCTGCCAACATGA